Project name: 12e73a57216e6b9

Status: done

Started: 2026-07-01 15:24:23
Settings
Chain sequence(s) B: GLTVEQQSPEVGAQLMQLALEAGELRVQWVSVSPSGKEEVIETATVVPVA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)
Show buried residues

Minimal score value
-2.6513
Maximal score value
2.1719
Average score
-0.6017
Total score value
-30.0826

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B 0.2534
2 L B 1.5074
3 T B 0.8245
4 V B 0.7441
5 E B -1.7031
6 Q B -2.2335
7 Q B -2.3237
8 S B -1.7082
9 P B -1.5834
10 E B -2.0389
11 V B -1.0621
12 G B -1.2284
13 A B -0.9694
14 Q B -1.0183
15 L B -0.1794
16 M B 0.2877
17 Q B -0.5809
18 L B -0.2091
19 A B 0.0000
20 L B 0.6462
21 E B -1.2898
22 A B -1.0304
23 G B -0.6627
24 E B -1.3670
25 L B -1.0605
26 R B -1.8863
27 V B -1.2854
28 Q B -1.2166
29 W B 0.0727
30 V B 0.0999
31 S B -0.2111
32 V B 0.1601
33 S B -0.8829
34 P B -0.6866
35 S B -1.0415
36 G B -1.6583
37 K B -2.6513
38 E B -2.3783
39 E B -1.9366
40 V B 0.0501
41 I B 0.3384
42 E B -1.1628
43 T B -1.0172
44 A B -0.8489
45 T B -0.6852
46 V B 0.5193
47 V B 1.3752
48 P B 1.4275
49 V B 2.1719
50 A B 1.2368
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018