Project name: query_structure

Status: done

Started: 2026-03-17 01:21:22
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYLITYGETGGNSPVQEFTVPGSKSTATISGLSPGVDYTITVYAGDWAYGWEYYYYNSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:27)
Show buried residues

Minimal score value
-2.6986
Maximal score value
2.4347
Average score
-0.2989
Total score value
-28.6929

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7949
2 S A 0.6644
3 S A 0.3148
4 V A 0.0280
5 P A 0.0000
6 T A -1.6908
7 K A -2.6632
8 L A 0.0000
9 E A -1.9323
10 V A 0.0931
11 V A 1.5302
12 A A 0.8907
13 A A 0.2904
14 T A -0.1931
15 P A -0.8170
16 T A -0.5440
17 S A -0.3117
18 L A 0.0000
19 L A 0.7413
20 I A 0.0000
21 S A -0.9728
22 W A 0.0000
23 D A -2.6986
24 A A -1.2309
25 P A -0.0123
26 A A 0.4219
27 V A 0.6139
28 T A -0.1435
29 V A -0.4503
30 D A -0.8208
31 H A 0.0000
32 Y A 0.0000
33 L A 0.0000
34 I A 0.0000
35 T A -0.4304
36 Y A -0.2831
37 G A 0.0000
38 E A -1.4523
39 T A -1.3213
40 G A -1.3729
41 G A -1.2624
42 N A -1.6887
43 S A -0.8405
44 P A -0.2777
45 V A 0.4758
46 Q A -0.8031
47 E A -1.5261
48 F A -0.5419
49 T A -0.2103
50 V A 0.0000
51 P A -0.9156
52 G A -1.1371
53 S A -1.1634
54 K A -2.0053
55 S A -1.4037
56 T A -0.7480
57 A A 0.0000
58 T A 0.2344
59 I A 0.0000
60 S A -0.4706
61 G A -0.6821
62 L A 0.0000
63 S A -0.8509
64 P A -1.0262
65 G A -1.1426
66 V A -1.0399
67 D A -1.8187
68 Y A -1.0779
69 T A -0.7450
70 I A 0.0000
71 T A -0.0893
72 V A 0.0000
73 Y A 0.2499
74 A A 0.0000
75 G A 0.0000
76 D A 0.0644
77 W A 1.6650
78 A A 1.6311
79 Y A 1.5986
80 G A 0.7088
81 W A 1.0898
82 E A -0.3319
83 Y A 1.9911
84 Y A 2.4347
85 Y A 2.1684
86 Y A 1.1785
87 N A -0.1166
88 S A -0.1959
89 P A -0.0917
90 I A -0.0259
91 S A -0.5416
92 I A -0.7034
93 N A -1.7043
94 Y A -1.4727
95 R A -2.3637
96 T A -1.2110
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018