Project name: 1437a8d0b47d430

Chain sequence(s)	A: GIVEQCCTSICSLYQLENYCN; C: GIVEQCCTSICSLYQLENYCN; B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT; D: FVNQHLCGSHLVEALYLVCGERGFFYTPK
Selected Chain(s)	A,B,C,D
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:47)

• Minimal score value: -2.7663
• Maximal score value: 2.2773
• Average score: -0.2135
• Total score value: -21.3491

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-1.5200
2	I	A	0.0000
3	V	A	-1.5153
4	E	A	-2.4000
5	Q	A	-1.5526
6	C	A	0.0000
7	C	A	-0.5463
8	T	A	-0.4256
9	S	A	0.3514
10	I	A	1.9527
11	C	A	1.2288
12	S	A	1.3210
13	L	A	2.0263
14	Y	A	1.2634
15	Q	A	0.2426
16	L	A	0.0000
17	E	A	-0.9979
18	N	A	-1.5611
19	Y	A	-0.7969
20	C	A	-1.3867
21	N	A	-1.6791
1	F	B	2.1335
2	V	B	1.9395
3	N	B	0.0954
4	Q	B	-0.4144
5	H	B	0.4348
6	L	B	0.9233
7	C	B	-0.0283
8	G	B	0.0000
9	S	B	-0.2445
10	H	B	-1.0040
11	L	B	0.0000
12	V	B	0.0000
13	E	B	-0.5831
14	A	B	0.2741
15	L	B	0.0000
16	Y	B	0.0000
17	L	B	1.2830
18	V	B	0.6935
19	C	B	0.0000
20	G	B	-1.0650
21	E	B	-2.7446
22	R	B	-2.5835
23	G	B	0.0000
24	F	B	0.0000
25	F	B	1.1046
26	Y	B	0.0000
27	T	B	-0.9475
28	P	B	-1.7582
29	K	B	-2.4851
1	G	C	-1.5122
2	I	C	0.0000
3	V	C	-1.5123
4	E	C	-2.3901
5	Q	C	-1.5801
6	C	C	0.0000
7	C	C	-0.4868
8	T	C	-0.4357
9	S	C	0.3194
10	I	C	1.8943
11	C	C	1.0900
12	S	C	1.2015
13	L	C	1.9864
14	Y	C	1.1868
15	Q	C	-0.0325
16	L	C	0.0000
17	E	C	-0.9120
18	N	C	-1.5605
19	Y	C	-0.9659
20	C	C	0.0000
21	N	C	-1.8511
1	F	D	2.2773
2	V	D	2.0498
3	N	D	0.1717
4	Q	D	-0.0712
5	H	D	0.6618
6	L	D	0.9205
7	C	D	0.0249
8	G	D	0.0000
9	S	D	-0.2940
10	H	D	-1.0537
11	L	D	0.0000
12	V	D	0.0000
13	E	D	-0.7258
14	A	D	0.2427
15	L	D	0.0000
16	Y	D	0.1457
17	L	D	1.3300
18	V	D	0.8462
19	C	D	0.0000
20	G	D	-1.2362
21	E	D	-2.7663
22	R	D	-2.5747
23	G	D	0.0000
24	F	D	0.0000
25	F	D	0.7163
26	Y	D	0.0000
27	T	D	-1.0574
28	P	D	-1.9205
29	K	D	-2.5036