Project name: gp63_004

Status: done

Started: 2026-04-27 14:57:04
Settings
Chain sequence(s) H: QVQLVESGGGLVQPGGSLRLSCAASGPSGFDFSTYSLGWFRQAPGQGLEAVAAIDPDGKTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADPSSSAGLVEPSDYEYWGQGTLVTVS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:18)
Show buried residues

Minimal score value
-2.6615
Maximal score value
1.651
Average score
-0.6941
Total score value
-88.1479

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q H -1.2713
2 V H -0.8823
3 Q H -1.0141
4 L H 0.0000
5 V H 1.2038
6 E H 0.0000
7 S H -0.1642
8 G H -0.6250
9 G H 0.1460
10 G H 0.6890
11 L H 1.3157
12 V H 0.0000
13 Q H -1.4776
14 P H -1.8432
15 G H -1.6467
16 G H -1.1997
17 S H -1.4218
18 L H -1.1078
19 R H -2.3638
20 L H 0.0000
21 S H -0.4468
22 C H 0.0000
23 A H -0.1590
24 A H -0.3767
25 S H -0.7348
26 G H -0.7668
27 P H -0.6935
28 S H -0.5045
29 G H -0.4226
30 F H -0.0065
31 D H -1.0281
32 F H 0.0000
33 S H -1.2995
34 T H -0.6750
35 Y H -0.4015
36 S H 0.0000
37 L H 0.0000
38 G H 0.0000
39 W H 0.0000
40 F H 0.0000
41 R H 0.0000
42 Q H -0.6441
43 A H -0.9543
44 P H -0.9108
45 G H -1.3017
46 Q H -1.8249
47 G H -1.2190
48 L H -0.6758
49 E H -0.9747
50 A H -0.3324
51 V H 0.0000
52 A H 0.0000
53 A H 0.0000
54 I H 0.0000
55 D H -1.1825
56 P H -1.5379
57 D H -2.6615
58 G H -2.1653
59 K H -2.4272
60 T H -1.1585
61 T H -0.0258
62 Y H 0.6087
63 Y H -0.3501
64 A H -1.1335
65 D H -2.3636
66 S H -1.7139
67 V H 0.0000
68 K H -2.4742
69 G H -1.8131
70 R H -1.7444
71 F H 0.0000
72 T H -0.9995
73 I H 0.0000
74 S H -0.8956
75 R H 0.0000
76 D H -2.0198
77 N H -2.1962
78 S H -1.6996
79 K H -2.4977
80 N H -2.0790
81 T H -1.0969
82 L H 0.0000
83 Y H 0.0000
84 L H 0.0000
85 Q H -1.7568
86 M H 0.0000
87 N H -2.1649
88 S H -1.5918
89 L H 0.0000
90 R H -2.6463
91 A H -1.8704
92 E H -2.3219
93 D H 0.0000
94 T H -0.4674
95 A H 0.0000
96 V H 0.8425
97 Y H 0.0000
98 Y H 0.4054
99 C H 0.0000
100 A H 0.0000
101 A H 0.0000
102 D H 0.0000
103 P H -0.8812
104 S H -0.8332
105 S H -0.5681
106 S H -0.3808
107 A H 0.0968
108 G H 0.2275
109 L H 0.3125
110 V H -0.7855
111 E H -2.1434
112 P H -1.6063
113 S H -1.8604
114 D H -2.5524
115 Y H 0.0000
116 E H -2.0331
117 Y H -0.9934
118 W H -0.1010
119 G H -0.0075
120 Q H -0.6247
121 G H 0.0000
122 T H 0.7072
123 L H 1.6510
124 V H 0.0000
125 T H 0.3088
126 V H 0.0000
127 S H -0.8660
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018