Project name: ef657fb3437b0e2 [mutate: VA41A, FA214A, FA217A] [mutate: YA67A]

Status: done

Started: 2026-07-19 13:20:19
Settings
Chain sequence(s) A: YPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIATGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPAKGAA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues YA67A
Energy difference between WT (input) and mutated protein (by FoldX) 1.5187 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:52)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:51)
Show buried residues

Minimal score value
-2.5782
Maximal score value
0.7161
Average score
-0.6852
Total score value
-149.3665

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 0.7161
2 P A -0.1688
3 Q A -1.1043
4 S A -0.6831
5 I A 0.0000
6 D A -1.0641
7 W A 0.0000
8 R A -1.5174
9 A A -1.3362
10 K A -2.0195
11 G A -1.3316
12 A A 0.0000
13 V A -0.5735
14 T A 0.0000
15 P A -0.6623
16 V A -0.7881
17 K A -0.9263
18 N A -1.5474
19 Q A 0.0000
20 G A -1.0792
21 A A -0.5661
22 C A 0.0000
23 G A -0.8155
24 S A 0.0000
25 C A -0.5285
26 W A 0.0000
27 A A 0.0000
28 F A 0.0000
29 S A 0.0000
30 T A 0.0000
31 I A 0.0000
32 A A -0.1611
33 T A 0.0000
34 V A 0.0000
35 E A 0.0000
36 G A 0.0000
37 I A 0.0000
38 N A 0.0000
39 K A -0.5482
40 I A 0.0180
41 A A -0.0314
42 T A -0.4810
43 G A -0.8360
44 N A -1.3078
45 L A -0.3518
46 L A -0.6670
47 E A -1.3610
48 L A 0.0000
49 S A 0.0000
50 E A 0.0000
51 Q A 0.0000
52 E A 0.0000
53 L A 0.0000
54 V A 0.0000
55 D A 0.0000
56 C A 0.0000
57 D A 0.0000
58 K A -1.9050
59 H A -1.5634
60 S A 0.0000
61 Y A -0.0308
62 G A 0.0000
63 C A -1.0667
64 K A -1.5535
65 G A -0.8162
66 G A -0.5949
67 A A -0.1746 mutated: YA67A
68 Q A 0.0000
69 T A -0.6015
70 T A -0.7296
71 S A 0.0000
72 L A 0.0000
73 Q A -0.9556
74 Y A -1.2904
75 V A 0.0000
76 A A 0.0000
77 N A -1.9877
78 N A -1.9325
79 G A 0.0000
80 V A 0.0000
81 H A 0.0000
82 T A 0.0000
83 S A -1.0748
84 K A -1.8345
85 V A -0.8674
86 Y A 0.0000
87 P A -0.6560
88 Y A -0.8182
89 Q A -1.1225
90 A A -1.3567
91 K A -2.1933
92 Q A -1.5505
93 Y A -1.0882
94 K A -1.5715
95 C A -1.1912
96 R A -1.3474
97 A A -1.3312
98 T A -1.2274
99 D A -2.2025
100 K A -1.8433
101 P A -1.3685
102 G A -1.3579
103 P A -1.5568
104 K A -2.4884
105 V A 0.0000
106 K A -2.2755
107 I A 0.0000
108 T A -0.8177
109 G A -0.9054
110 Y A -0.9313
111 K A -2.1613
112 R A -2.0814
113 V A 0.0000
114 P A -0.9758
115 S A -1.0875
116 N A -1.4930
117 C A -1.1479
118 E A -0.9704
119 T A -0.3545
120 S A -0.4335
121 F A 0.0000
122 L A 0.0000
123 G A -0.1245
124 A A -0.4583
125 L A 0.0000
126 A A -0.5205
127 N A -0.9810
128 Q A 0.0000
129 P A 0.0000
130 L A 0.0000
131 S A 0.0000
132 V A 0.0000
133 L A -0.2384
134 V A 0.0000
135 E A 0.0000
136 A A 0.0000
137 G A -1.6504
138 G A -1.3881
139 K A -1.7567
140 P A -1.1707
141 F A 0.0000
142 Q A -0.8706
143 L A 0.1257
144 Y A 0.0000
145 K A -2.0546
146 S A -1.3183
147 G A -1.0399
148 V A -1.1484
149 F A 0.0000
150 D A -2.0245
151 G A -1.3496
152 P A -1.0073
153 C A -1.0251
154 G A -0.8480
155 T A -1.2484
156 K A -2.0527
157 L A -1.3637
158 D A -2.0617
159 H A 0.0000
160 A A 0.0000
161 V A 0.0000
162 T A 0.0000
163 A A 0.0000
164 V A 0.0000
165 G A 0.0000
166 Y A 0.0000
167 G A 0.0000
168 T A -1.3100
169 S A -1.5016
170 D A -2.3724
171 G A -1.8687
172 K A -1.9385
173 N A -1.6215
174 Y A -0.9000
175 I A 0.0000
176 I A 0.0000
177 I A 0.0000
178 K A 0.0000
179 N A 0.0000
180 S A 0.0000
181 W A -0.9277
182 G A 0.0000
183 P A -1.7547
184 N A -2.2442
185 W A 0.0000
186 G A -1.8074
187 E A -2.1031
188 K A -2.5782
189 G A 0.0000
190 Y A 0.0000
191 M A 0.0000
192 R A -0.7476
193 L A 0.0000
194 K A -1.3753
195 R A 0.0000
196 Q A -1.5033
197 S A -1.1281
198 G A -1.2271
199 N A -1.8237
200 S A -1.5363
201 Q A -1.6839
202 G A 0.0000
203 T A 0.0000
204 C A 0.0000
205 G A 0.0000
206 V A 0.0000
207 Y A 0.0000
208 K A -0.7684
209 S A -0.5235
210 S A 0.0000
211 Y A -0.8274
212 Y A -0.6763
213 P A 0.0000
214 A A -0.5441
215 K A -0.5510
216 G A -0.7014
217 A A -0.3966
218 A A -0.2399
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018