| Chain sequence(s) |
A: MVPILVTLDATVNGHTFTVSGEGEGSAKAGTLTLQFKCTTEELPVPWPTLVTTLTYGVQCFSRYPEEDKAKDFFKKWMPTGYEQTRTIKFDNDGSYKTRATVKFVGDVLKNRILLLGSNFKEDSVIASHALEYSFNSHTVTIYSSEKEDGIKASFTIEHLCKDGKVLTAKHYQQNKPRGDGELNLPEEGTLTTTSTLSKDPRSSEDSMKLTEHVEAS
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 5 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:00)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:03:54)
[INFO] Auto_mut: Residue number 116 from chain A and a score of 1.548 (leucine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 1 from chain A and a score of 1.135 (methionine) selected
for automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 105 from chain A and a score of 1.115 (valine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 172 from chain A and a score of 1.072 omitted from automated
muatation (excluded by the user). (00:03:55)
[INFO] Auto_mut: Residue number 114 from chain A and a score of 0.799 (leucine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 166 from chain A and a score of 0.778 (valine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 2 from chain A and a score of 0.626 omitted from automated
muatation (excluded by the user). (00:03:55)
[INFO] Auto_mut: Residue number 104 from chain A and a score of 0.594 omitted from automated
muatation (excluded by the user). (00:03:55)
[INFO] Auto_mut: Residue number 160 from chain A and a score of 0.581 (leucine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 125 from chain A and a score of 0.506 (valine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 143 from chain A and a score of 0.241 (tyrosine) selected
for automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 108 from chain A and a score of 0.205 (valine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Residue number 197 from chain A and a score of 0.124 omitted from automated
muatation (excluded by the user). (00:03:55)
[INFO] Auto_mut: Residue number 78 from chain A and a score of 0.079 omitted from automated
muatation (excluded by the user). (00:03:55)
[INFO] Auto_mut: Residue number 135 from chain A and a score of 0.078 omitted from automated
muatation (excluded by the user). (00:03:55)
[INFO] Auto_mut: Residue number 133 from chain A and a score of 0.057 omitted from automated
muatation (excluded by the user). (00:03:55)
[INFO] Auto_mut: Residue number 134 from chain A and a score of 0.038 (serine) selected for
automated muatation (00:03:55)
[INFO] Auto_mut: Mutating residue number 116 from chain A (leucine) into glutamic acid (00:03:55)
[INFO] Auto_mut: Mutating residue number 105 from chain A (valine) into glutamic acid (00:03:55)
[INFO] Auto_mut: Mutating residue number 1 from chain A (methionine) into glutamic acid (00:03:55)
[INFO] Auto_mut: Mutating residue number 1 from chain A (methionine) into lysine (00:05:41)
[INFO] Auto_mut: Mutating residue number 105 from chain A (valine) into lysine (00:06:06)
[INFO] Auto_mut: Mutating residue number 116 from chain A (leucine) into lysine (00:06:15)
[INFO] Auto_mut: Mutating residue number 1 from chain A (methionine) into aspartic acid (00:07:52)
[INFO] Auto_mut: Mutating residue number 105 from chain A (valine) into aspartic acid (00:08:18)
[INFO] Auto_mut: Mutating residue number 116 from chain A (leucine) into aspartic acid (00:08:37)
[INFO] Auto_mut: Mutating residue number 1 from chain A (methionine) into arginine (00:09:57)
[INFO] Auto_mut: Mutating residue number 105 from chain A (valine) into arginine (00:10:43)
[INFO] Auto_mut: Mutating residue number 116 from chain A (leucine) into arginine (00:10:45)
[INFO] Auto_mut: Mutating residue number 114 from chain A (leucine) into glutamic acid (00:12:11)
[INFO] Auto_mut: Mutating residue number 166 from chain A (valine) into glutamic acid (00:12:56)
[INFO] Auto_mut: Mutating residue number 160 from chain A (leucine) into glutamic acid (00:13:01)
[INFO] Auto_mut: Mutating residue number 114 from chain A (leucine) into lysine (00:14:29)
[INFO] Auto_mut: Mutating residue number 166 from chain A (valine) into lysine (00:15:04)
[INFO] Auto_mut: Mutating residue number 160 from chain A (leucine) into lysine (00:15:08)
[INFO] Auto_mut: Mutating residue number 114 from chain A (leucine) into aspartic acid (00:17:05)
[INFO] Auto_mut: Mutating residue number 166 from chain A (valine) into aspartic acid (00:17:34)
[INFO] Auto_mut: Mutating residue number 160 from chain A (leucine) into aspartic acid (00:17:36)
[INFO] Auto_mut: Mutating residue number 114 from chain A (leucine) into arginine (00:19:17)
[INFO] Auto_mut: Mutating residue number 166 from chain A (valine) into arginine (00:19:39)
[INFO] Auto_mut: Mutating residue number 160 from chain A (leucine) into arginine (00:19:42)
[INFO] Auto_mut: Mutating residue number 125 from chain A (valine) into glutamic acid (00:21:31)
[INFO] Auto_mut: Mutating residue number 143 from chain A (tyrosine) into glutamic acid (00:21:49)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into glutamic acid (00:21:55)
[INFO] Auto_mut: Mutating residue number 125 from chain A (valine) into lysine (00:23:41)
[INFO] Auto_mut: Mutating residue number 143 from chain A (tyrosine) into lysine (00:24:06)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into lysine (00:24:08)
[INFO] Auto_mut: Mutating residue number 125 from chain A (valine) into aspartic acid (00:25:53)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into aspartic acid (00:26:24)
[INFO] Auto_mut: Mutating residue number 143 from chain A (tyrosine) into aspartic acid (00:26:42)
[INFO] Auto_mut: Mutating residue number 125 from chain A (valine) into arginine (00:27:58)
[INFO] Auto_mut: Mutating residue number 108 from chain A (valine) into arginine (00:28:33)
[INFO] Auto_mut: Mutating residue number 143 from chain A (tyrosine) into arginine (00:29:02)
[INFO] Auto_mut: Mutating residue number 134 from chain A (serine) into glutamic acid (00:30:05)
[INFO] Auto_mut: Mutating residue number 134 from chain A (serine) into lysine (00:32:18)
[INFO] Auto_mut: Mutating residue number 134 from chain A (serine) into aspartic acid (00:34:45)
[INFO] Auto_mut: Mutating residue number 134 from chain A (serine) into arginine (00:37:04)
[INFO] Auto_mut: Effect of mutation residue number 116 from chain A (leucine) into glutamic
acid: Energy difference: 0.6806 kcal/mol, Difference in average score from
the base case: -0.0094 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 116 from chain A (leucine) into lysine:
Energy difference: 0.2520 kcal/mol, Difference in average score from the
base case: -0.0094 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 116 from chain A (leucine) into aspartic
acid: Energy difference: 0.7555 kcal/mol, Difference in average score from
the base case: -0.0087 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 116 from chain A (leucine) into arginine:
Energy difference: 0.3271 kcal/mol, Difference in average score from the
base case: -0.0135 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (methionine) into glutamic
acid: Energy difference: 1.3787 kcal/mol, Difference in average score from
the base case: -0.0185 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (methionine) into lysine:
Energy difference: 0.6428 kcal/mol, Difference in average score from the
base case: -0.0150 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (methionine) into aspartic
acid: Energy difference: 1.6554 kcal/mol, Difference in average score from
the base case: -0.0158 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (methionine) into
arginine: Energy difference: 0.8754 kcal/mol, Difference in average score
from the base case: -0.0142 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 105 from chain A (valine) into glutamic
acid: Energy difference: -0.1716 kcal/mol, Difference in average score from
the base case: -0.0159 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 105 from chain A (valine) into lysine:
Energy difference: 0.6725 kcal/mol, Difference in average score from the
base case: -0.0164 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 105 from chain A (valine) into aspartic
acid: Energy difference: -0.7453 kcal/mol, Difference in average score from
the base case: -0.0180 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 105 from chain A (valine) into arginine:
Energy difference: 0.5382 kcal/mol, Difference in average score from the
base case: -0.0188 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (leucine) into glutamic
acid: Energy difference: 0.8284 kcal/mol, Difference in average score from
the base case: -0.0154 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (leucine) into lysine:
Energy difference: 0.3605 kcal/mol, Difference in average score from the
base case: -0.0099 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (leucine) into aspartic
acid: Energy difference: 1.4674 kcal/mol, Difference in average score from
the base case: -0.0126 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (leucine) into arginine:
Energy difference: 0.3639 kcal/mol, Difference in average score from the
base case: -0.0125 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (valine) into glutamic
acid: Energy difference: 1.2755 kcal/mol, Difference in average score from
the base case: -0.0147 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (valine) into lysine:
Energy difference: -0.0952 kcal/mol, Difference in average score from the
base case: -0.0133 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (valine) into aspartic
acid: Energy difference: 2.0966 kcal/mol, Difference in average score from
the base case: -0.0143 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (valine) into arginine:
Energy difference: -0.0192 kcal/mol, Difference in average score from the
base case: -0.0167 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (leucine) into glutamic
acid: Energy difference: 0.9307 kcal/mol, Difference in average score from
the base case: -0.0028 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (leucine) into lysine:
Energy difference: -0.1331 kcal/mol, Difference in average score from the
base case: -0.0030 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (leucine) into aspartic
acid: Energy difference: 0.5543 kcal/mol, Difference in average score from
the base case: -0.0032 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (leucine) into arginine:
Energy difference: -0.7276 kcal/mol, Difference in average score from the
base case: -0.0020 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 125 from chain A (valine) into glutamic
acid: Energy difference: 0.7933 kcal/mol, Difference in average score from
the base case: -0.0055 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 125 from chain A (valine) into lysine:
Energy difference: 0.0646 kcal/mol, Difference in average score from the
base case: -0.0043 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 125 from chain A (valine) into aspartic
acid: Energy difference: 1.7934 kcal/mol, Difference in average score from
the base case: -0.0051 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 125 from chain A (valine) into arginine:
Energy difference: -0.0376 kcal/mol, Difference in average score from the
base case: -0.0034 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 143 from chain A (tyrosine) into glutamic
acid: Energy difference: 1.9641 kcal/mol, Difference in average score from
the base case: -0.0074 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 143 from chain A (tyrosine) into lysine:
Energy difference: 0.7695 kcal/mol, Difference in average score from the
base case: -0.0055 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 143 from chain A (tyrosine) into aspartic
acid: Energy difference: 2.1908 kcal/mol, Difference in average score from
the base case: -0.0069 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 143 from chain A (tyrosine) into
arginine: Energy difference: 0.6066 kcal/mol, Difference in average score
from the base case: -0.0074 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into glutamic
acid: Energy difference: 1.2061 kcal/mol, Difference in average score from
the base case: -0.0063 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into lysine:
Energy difference: -0.0601 kcal/mol, Difference in average score from the
base case: -0.0029 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into aspartic
acid: Energy difference: 1.9527 kcal/mol, Difference in average score from
the base case: -0.0063 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 108 from chain A (valine) into arginine:
Energy difference: 0.4721 kcal/mol, Difference in average score from the
base case: -0.0077 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 134 from chain A (serine) into glutamic
acid: Energy difference: 0.0397 kcal/mol, Difference in average score from
the base case: -0.0006 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 134 from chain A (serine) into lysine:
Energy difference: -1.0234 kcal/mol, Difference in average score from the
base case: -0.0010 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 134 from chain A (serine) into aspartic
acid: Energy difference: 0.6291 kcal/mol, Difference in average score from
the base case: -0.0056 (00:39:17)
[INFO] Auto_mut: Effect of mutation residue number 134 from chain A (serine) into arginine:
Energy difference: -0.9860 kcal/mol, Difference in average score from the
base case: -0.0029 (00:39:17)
[INFO] Main: Simulation completed successfully. (00:39:25)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | M | A | 1.1345 | |
| 2 | V | A | 0.6260 | |
| 3 | P | A | -0.1594 | |
| 4 | I | A | 0.0000 | |
| 5 | L | A | -0.0018 | |
| 6 | V | A | 0.0000 | |
| 7 | T | A | -0.2016 | |
| 8 | L | A | 0.0000 | |
| 9 | D | A | -1.2382 | |
| 10 | A | A | 0.0000 | |
| 11 | T | A | -0.0297 | |
| 12 | V | A | 0.0000 | |
| 13 | N | A | -1.3566 | |
| 14 | G | A | -0.8241 | |
| 15 | H | A | -0.8238 | |
| 16 | T | A | -0.2055 | |
| 17 | F | A | 0.0000 | |
| 18 | T | A | -0.1633 | |
| 19 | V | A | 0.0000 | |
| 20 | S | A | -0.0554 | |
| 21 | G | A | 0.0000 | |
| 22 | E | A | -1.8153 | |
| 23 | G | A | -0.6969 | |
| 24 | E | A | -1.2902 | |
| 25 | G | A | 0.0000 | |
| 26 | S | A | -0.0277 | |
| 27 | A | A | -0.2946 | |
| 28 | K | A | -1.6924 | |
| 29 | A | A | -0.2818 | |
| 30 | G | A | 0.0000 | |
| 31 | T | A | -0.0702 | |
| 32 | L | A | 0.0000 | |
| 33 | T | A | -0.0262 | |
| 34 | L | A | 0.0000 | |
| 35 | Q | A | -1.2690 | |
| 36 | F | A | 0.0000 | |
| 37 | K | A | -0.8505 | |
| 38 | C | A | 0.0000 | |
| 39 | T | A | -0.0582 | |
| 40 | T | A | -0.3795 | |
| 41 | E | A | -2.1566 | |
| 42 | E | A | -2.1489 | |
| 43 | L | A | 0.0000 | |
| 44 | P | A | -0.0416 | |
| 45 | V | A | 0.0000 | |
| 46 | P | A | 0.0000 | |
| 47 | W | A | 0.0000 | |
| 48 | P | A | 0.0000 | |
| 49 | T | A | 0.0000 | |
| 50 | L | A | 0.0000 | |
| 51 | V | A | 0.0000 | |
| 52 | T | A | 0.0000 | |
| 53 | T | A | 0.0000 | |
| 54 | L | A | 0.0000 | |
| 55 | T | A | 0.0000 | |
| 56 | Y | A | 0.0000 | |
| 57 | G | A | 0.0000 | |
| 58 | V | A | 0.0000 | |
| 59 | Q | A | 0.0000 | |
| 60 | C | A | 0.0000 | |
| 61 | F | A | 0.0000 | |
| 62 | S | A | 0.0000 | |
| 63 | R | A | -0.8119 | |
| 64 | Y | A | -0.0220 | |
| 65 | P | A | -0.3902 | |
| 66 | E | A | -2.1647 | |
| 67 | E | A | -2.2161 | |
| 68 | D | A | -1.0020 | |
| 69 | K | A | -1.7556 | |
| 70 | A | A | -0.3428 | |
| 71 | K | A | -0.5106 | |
| 72 | D | A | 0.0000 | |
| 73 | F | A | 0.0000 | |
| 74 | F | A | 0.0000 | |
| 75 | K | A | -0.9045 | |
| 76 | K | A | -1.8075 | |
| 77 | W | A | 0.0000 | |
| 78 | M | A | 0.0791 | |
| 79 | P | A | -0.2201 | |
| 80 | T | A | -0.0707 | |
| 81 | G | A | 0.0000 | |
| 82 | Y | A | 0.0000 | |
| 83 | E | A | -0.2060 | |
| 84 | Q | A | 0.0000 | |
| 85 | T | A | -0.2731 | |
| 86 | R | A | 0.0000 | |
| 87 | T | A | -0.2121 | |
| 88 | I | A | 0.0000 | |
| 89 | K | A | -1.1179 | |
| 90 | F | A | 0.0000 | |
| 91 | D | A | -2.0199 | |
| 92 | N | A | -1.6528 | |
| 93 | D | A | -0.5396 | |
| 94 | G | A | 0.0000 | |
| 95 | S | A | -0.1662 | |
| 96 | Y | A | 0.0000 | |
| 97 | K | A | -1.7014 | |
| 98 | T | A | 0.0000 | |
| 99 | R | A | -1.8485 | |
| 100 | A | A | 0.0000 | |
| 101 | T | A | -0.0407 | |
| 102 | V | A | 0.0000 | |
| 103 | K | A | -0.3654 | |
| 104 | F | A | 0.5936 | |
| 105 | V | A | 1.1155 | |
| 106 | G | A | -0.5830 | |
| 107 | D | A | -1.7801 | |
| 108 | V | A | 0.2049 | |
| 109 | L | A | 0.0000 | |
| 110 | K | A | -0.3470 | |
| 111 | N | A | 0.0000 | |
| 112 | R | A | -1.8167 | |
| 113 | I | A | 0.0000 | |
| 114 | L | A | 0.7986 | |
| 115 | L | A | 0.0000 | |
| 116 | L | A | 1.5477 | |
| 117 | G | A | 0.0000 | |
| 118 | S | A | -0.4245 | |
| 119 | N | A | -1.3081 | |
| 120 | F | A | 0.0000 | |
| 121 | K | A | -2.0297 | |
| 122 | E | A | -2.4485 | |
| 123 | D | A | -2.1154 | |
| 124 | S | A | 0.0000 | |
| 125 | V | A | 0.5058 | |
| 126 | I | A | 0.0000 | |
| 127 | A | A | -0.0045 | |
| 128 | S | A | -0.3453 | |
| 129 | H | A | -0.8156 | |
| 130 | A | A | -0.0788 | |
| 131 | L | A | 0.0000 | |
| 132 | E | A | -1.5729 | |
| 133 | Y | A | 0.0565 | |
| 134 | S | A | 0.0376 | |
| 135 | F | A | 0.0779 | |
| 136 | N | A | -0.5770 | |
| 137 | S | A | -0.3435 | |
| 138 | H | A | -0.1545 | |
| 139 | T | A | -0.0937 | |
| 140 | V | A | 0.0000 | |
| 141 | T | A | -0.0238 | |
| 142 | I | A | 0.0000 | |
| 143 | Y | A | 0.2407 | |
| 144 | S | A | 0.0320 | |
| 145 | S | A | 0.0000 | |
| 146 | E | A | -2.1249 | |
| 147 | K | A | -2.3559 | |
| 148 | E | A | -2.4483 | |
| 149 | D | A | -2.1156 | |
| 150 | G | A | 0.0000 | |
| 151 | I | A | 0.0000 | |
| 152 | K | A | -0.8072 | |
| 153 | A | A | 0.0000 | |
| 154 | S | A | -0.0436 | |
| 155 | F | A | 0.0000 | |
| 156 | T | A | -0.1610 | |
| 157 | I | A | 0.0000 | |
| 158 | E | A | -1.3683 | |
| 159 | H | A | 0.0000 | |
| 160 | L | A | 0.5813 | |
| 161 | C | A | 0.0000 | |
| 162 | K | A | -1.9974 | |
| 163 | D | A | -2.0506 | |
| 164 | G | A | -1.0683 | |
| 165 | K | A | -1.5950 | |
| 166 | V | A | 0.7777 | |
| 167 | L | A | 0.0000 | |
| 168 | T | A | -0.1713 | |
| 169 | A | A | 0.0000 | |
| 170 | K | A | -1.0612 | |
| 171 | H | A | 0.0000 | |
| 172 | Y | A | 1.0720 | |
| 173 | Q | A | 0.0000 | |
| 174 | Q | A | -0.4102 | |
| 175 | N | A | 0.0000 | |
| 176 | K | A | -0.8975 | |
| 177 | P | A | -0.4077 | |
| 178 | R | A | -1.1870 | |
| 179 | G | A | -0.6592 | |
| 180 | D | A | -1.8952 | |
| 181 | G | A | -1.1281 | |
| 182 | E | A | -1.8288 | |
| 183 | L | A | -0.1397 | |
| 184 | N | A | -1.1628 | |
| 185 | L | A | -0.0581 | |
| 186 | P | A | 0.0000 | |
| 187 | E | A | -2.1526 | |
| 188 | E | A | -2.1222 | |
| 189 | G | A | -0.4215 | |
| 190 | T | A | -0.0397 | |
| 191 | L | A | 0.0000 | |
| 192 | T | A | -0.0394 | |
| 193 | T | A | 0.0000 | |
| 194 | T | A | -0.0866 | |
| 195 | S | A | 0.0000 | |
| 196 | T | A | -0.0411 | |
| 197 | L | A | 0.1237 | |
| 198 | S | A | -0.4229 | |
| 199 | K | A | -1.8414 | |
| 200 | D | A | -0.9835 | |
| 201 | P | A | -0.6943 | |
| 202 | R | A | -1.9015 | |
| 203 | S | A | -0.4403 | |
| 204 | S | A | -0.5325 | |
| 205 | E | A | -1.8901 | |
| 206 | D | A | -1.0959 | |
| 207 | S | A | -0.3030 | |
| 208 | M | A | 0.0000 | |
| 209 | K | A | -0.6874 | |
| 210 | L | A | 0.0000 | |
| 211 | T | A | -0.0271 | |
| 212 | E | A | 0.0000 | |
| 213 | H | A | -0.4389 | |
| 214 | V | A | 0.0000 | |
| 215 | E | A | -1.0889 | |
| 216 | A | A | 0.0000 | |
| 217 | S | A | -0.2129 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VD105A | -0.7453 | -0.018 | View | CSV | PDB |
| VE105A | -0.1716 | -0.0159 | View | CSV | PDB |
| VR166A | -0.0192 | -0.0167 | View | CSV | PDB |
| VK166A | -0.0952 | -0.0133 | View | CSV | PDB |
| SR134A | -0.986 | -0.0029 | View | CSV | PDB |
| LR160A | -0.7276 | -0.002 | View | CSV | PDB |
| LK160A | -0.1331 | -0.003 | View | CSV | PDB |
| VR125A | -0.0376 | -0.0034 | View | CSV | PDB |
| VK108A | -0.0601 | -0.0029 | View | CSV | PDB |
| SK134A | -1.0234 | -0.001 | View | CSV | PDB |
| VK125A | 0.0646 | -0.0043 | View | CSV | PDB |
| LR116A | 0.3271 | -0.0135 | View | CSV | PDB |
| LK116A | 0.252 | -0.0094 | View | CSV | PDB |
| LR114A | 0.3639 | -0.0125 | View | CSV | PDB |
| LK114A | 0.3605 | -0.0099 | View | CSV | PDB |
| MK1A | 0.6428 | -0.015 | View | CSV | PDB |
| VR108A | 0.4721 | -0.0077 | View | CSV | PDB |
| MR1A | 0.8754 | -0.0142 | View | CSV | PDB |
| YR143A | 0.6066 | -0.0074 | View | CSV | PDB |
| YK143A | 0.7695 | -0.0055 | View | CSV | PDB |
ALA alanine
ARG arginine
ASN asparagine
ASP aspartic acid
CYS cysteine
GLN glutamine
GLU glutamic acid
GLY glycine
HIS histidine
ILE isoleucine
LEU leucine
LYS lysine
MET methionine
PHE phenylalanine
PRO proline
SER serine
THR threonine
TRP tryptophan
TYR tyrosine
VAL valine