Project name: 14b980d5276d09e

Status: done

Started: 2026-06-27 09:56:41
Settings
Chain sequence(s) A: MSHHHHHHSGSEYAERLTGDREKGEELLREMREEIAKILKENGIEIEPDSPEMLEFMRRVLEAALEEELELPELRIEKYYYDDYHLRYLGKELARDNEKVVKVVRDFVVKKAKEQGIPEEKGEEVAEEVLEVVGYYLAKMLYAGLLSKRNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:08:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:08)
Show buried residues

Minimal score value
-5.1827
Maximal score value
1.4672
Average score
-1.6706
Total score value
-252.2668

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5457
2 S A -0.6267
3 H A -1.7423
4 H A -2.3423
5 H A -2.6617
6 H A -2.5750
7 H A -2.6232
8 H A -2.1532
9 S A -1.6185
10 G A 0.0000
11 S A -2.6714
12 E A -3.1377
13 Y A -2.2327
14 A A 0.0000
15 E A -4.0300
16 R A -2.8179
17 L A -1.2073
18 T A -1.9723
19 G A -2.3697
20 D A -3.9269
21 R A -5.1827
22 E A -4.6110
23 K A -3.9611
24 G A 0.0000
25 E A -4.7535
26 E A -4.1070
27 L A -2.0303
28 L A 0.0000
29 R A -3.9676
30 E A -3.6038
31 M A -2.2957
32 R A -2.5213
33 E A -3.5093
34 E A -3.2029
35 I A -1.8017
36 A A 0.0000
37 K A -3.2517
38 I A -1.2073
39 L A -1.7486
40 K A -3.5132
41 E A -3.1768
42 N A -2.5487
43 G A -1.9229
44 I A -1.0452
45 E A -2.4294
46 I A -2.1874
47 E A -3.2445
48 P A -3.3854
49 D A -2.9746
50 S A -1.9934
51 P A -1.5542
52 E A -2.1236
53 M A 0.0000
54 L A -1.1300
55 E A -0.8539
56 F A -0.0604
57 M A 0.0000
58 R A -1.3275
59 R A -1.6251
60 V A -0.1708
61 L A 0.0000
62 E A -1.8655
63 A A -1.5488
64 A A -1.3406
65 L A -2.0244
66 E A -3.0065
67 E A -3.2973
68 E A -2.7788
69 L A -0.6324
70 E A -1.1836
71 L A 0.6872
72 P A -0.5318
73 E A -1.3175
74 L A 0.2679
75 R A -1.4249
76 I A 0.1828
77 E A -1.6062
78 K A -1.8041
79 Y A -0.0852
80 Y A 0.8959
81 Y A 0.2781
82 D A -0.5771
83 D A -1.1921
84 Y A 0.2894
85 H A -0.3108
86 L A 0.0000
87 R A -0.9620
88 Y A 0.0517
89 L A -0.4934
90 G A 0.0000
91 K A -2.3954
92 E A -3.0133
93 L A -1.9015
94 A A 0.0000
95 R A -4.4957
96 D A -4.0227
97 N A -3.6405
98 E A -3.7742
99 K A -3.1912
100 V A -1.8735
101 V A -2.7517
102 K A -2.4792
103 V A 0.0979
104 V A 0.0000
105 R A -2.0855
106 D A -1.7734
107 F A 0.2767
108 V A 0.0000
109 V A -2.8746
110 K A -3.2851
111 K A -2.8334
112 A A 0.0000
113 K A -3.6056
114 E A -3.7199
115 Q A -2.9363
116 G A -2.0132
117 I A -1.8373
118 P A -2.2288
119 E A -3.3656
120 E A -3.5744
121 K A -3.3129
122 G A 0.0000
123 E A -4.1378
124 E A -4.0032
125 V A -2.4022
126 A A 0.0000
127 E A -3.7249
128 E A -2.8960
129 V A -1.0534
130 L A 0.0000
131 E A -1.9219
132 V A 0.2219
133 V A 0.4320
134 G A 0.0000
135 Y A 0.0000
136 Y A 1.4672
137 L A 1.2755
138 A A 0.0000
139 K A 0.0177
140 M A 1.4534
141 L A 1.4366
142 Y A 1.0666
143 A A 0.3240
144 G A -0.0376
145 L A -0.2914
146 L A -0.4035
147 S A -1.5456
148 K A -2.8122
149 R A -3.0609
150 N A -2.6197
151 S A -1.9255
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018