Project name: 151f10df640f63e

Chain sequence(s)	A: NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)

• Minimal score value: -2.7847
• Maximal score value: 1.1917
• Average score: -0.7914
• Total score value: -86.2667

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.3300
2	F	A	0.0000
3	L	A	1.1917
4	L	A	0.0000
5	T	A	0.0939
6	Q	A	0.0000
7	P	A	-0.9719
8	H	A	-1.6715
9	S	A	-1.3920
10	V	A	-0.7347
11	S	A	-0.4243
12	E	A	-0.6239
13	S	A	-0.4744
14	P	A	-0.9929
15	G	A	-1.6413
16	K	A	-2.0194
17	T	A	-1.2053
18	V	A	0.0000
19	T	A	-0.1906
20	I	A	0.0000
21	S	A	-0.1059
22	C	A	0.0000
23	T	A	-0.3075
24	R	A	-0.1440
25	S	A	-0.2003
26	S	A	-0.5551
27	G	A	-1.1056
28	S	A	-1.0372
29	I	A	0.0000
30	A	A	-0.8104
31	N	A	-1.3781
32	N	A	-0.8418
33	Y	A	0.3314
34	V	A	0.0000
35	H	A	-0.1678
36	W	A	0.0000
37	Y	A	0.0580
38	Q	A	0.0000
39	Q	A	-1.6184
40	R	A	-2.4990
41	P	A	-1.4523
42	G	A	-1.0670
43	S	A	-1.0472
44	S	A	-0.7979
45	P	A	-0.7553
46	T	A	-0.3631
47	T	A	-0.0207
48	V	A	0.0000
49	I	A	0.0000
50	F	A	-0.6423
51	E	A	-1.1570
52	D	A	-1.2974
53	D	A	-2.4366
54	H	A	-2.1808
55	R	A	-1.9767
56	P	A	-0.8321
57	S	A	-0.8482
58	G	A	-0.8336
59	V	A	-0.7455
60	P	A	-1.2466
61	D	A	-2.1757
62	R	A	-1.2624
63	F	A	0.0000
64	S	A	-1.3911
65	G	A	-1.2291
66	S	A	-1.1452
67	V	A	-0.6827
68	D	A	-1.7485
69	T	A	-1.0421
70	S	A	-0.9354
71	N	A	-1.0564
72	S	A	-0.8617
73	A	A	0.0000
74	S	A	-0.6201
75	L	A	0.0000
76	T	A	-0.2597
77	I	A	0.0000
78	S	A	-1.1937
79	G	A	-1.2665
80	L	A	0.0000
81	K	A	-2.1907
82	T	A	-1.6752
83	E	A	-2.7358
84	D	A	0.0000
85	E	A	-2.6001
86	A	A	0.0000
87	D	A	-1.8951
88	Y	A	0.0000
89	Y	A	-0.0057
90	C	A	0.0000
91	Q	A	0.0000
92	S	A	0.0000
93	Y	A	-1.3121
94	D	A	-2.1302
95	H	A	-2.4842
96	N	A	-2.6426
97	N	A	-2.7847
98	Q	A	-1.8632
99	V	A	-0.3355
100	F	A	0.9710
101	G	A	0.6079
102	G	A	-0.4276
103	G	A	-0.8242
104	T	A	0.0000
105	K	A	-2.5823
106	L	A	0.0000
107	T	A	-0.7509
108	V	A	-0.3624
109	L	A	1.0958