Project name: 15220c07cac17ec

Status: done

Started: 2026-04-14 16:33:54
Settings
Chain sequence(s) A: GIVEQCCTSICSLYQLENYCN
C: GIVEQCCTSICSLYQLENYCN
B: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
D: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
input PDB
Selected Chain(s) A,C,B,D
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.8335
Maximal score value
2.3797
Average score
-0.4338
Total score value
-44.2482

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -1.3627
2 I A 0.0000
3 V A 0.0000
4 E A -2.5759
5 Q A -1.6029
6 C A 0.0000
7 C A -0.3510
8 T A -0.3071
9 S A 0.3675
10 I A 1.8913
11 C A 1.0984
12 S A 1.2301
13 L A 1.8933
14 Y A 1.1489
15 Q A -0.0566
16 L A 0.0000
17 E A -1.1539
18 N A -1.5785
19 Y A -0.5350
20 C A -1.1599
21 N A -1.6350
1 F B 1.7320
2 V B 0.4908
3 N B -0.6609
4 Q B -1.2772
5 H B -1.1070
6 L B 0.3382
7 C B -0.2966
8 G B 0.0000
9 S B -0.5256
10 H B -1.3128
11 L B 0.0000
12 V B 0.0000
13 E B -1.4488
14 A B -0.1338
15 L B 0.0000
16 Y B -0.0486
17 L B 1.4087
18 V B 0.8669
19 C B 0.0000
20 G B -1.0536
21 E B -2.7518
22 R B -2.6769
23 G B 0.0000
24 F B 0.0000
25 F B 1.7323
26 Y B 0.0000
27 T B -0.8646
28 P B -1.8447
29 K B -2.4284
30 A B -1.3758
1 G C -1.2312
2 I C 0.0000
3 V C -1.0880
4 E C -2.2404
5 Q C -1.6530
6 C C 0.0000
7 C C -0.7689
8 T C -0.8436
9 S C -0.7201
10 I C -0.3575
11 C C 0.0000
12 S C 0.4663
13 L C 1.0182
14 Y C 0.6370
15 Q C -0.5896
16 L C 0.0000
17 E C -1.0752
18 N C -1.5575
19 Y C -0.8377
20 C C -1.2876
21 N C -1.6885
1 F D 2.3797
2 V D 1.6699
3 N D -0.2962
4 Q D -0.6669
5 H D -1.1924
6 L D 0.0000
7 C D -0.4967
8 G D -0.2480
9 S D -0.7554
10 H D -1.4089
11 L D 0.0000
12 V D 0.0000
13 E D -0.8454
14 A D 0.0000
15 L D 0.0000
16 Y D -0.0468
17 L D 1.1323
18 V D 0.7749
19 C D 0.0000
20 G D -1.2826
21 E D -2.8335
22 R D -2.5527
23 G D 0.0000
24 F D 0.0000
25 F D 0.7815
26 Y D 0.0000
27 T D -0.9034
28 P D -1.7851
29 K D -2.5813
30 A D -1.3467
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018