Project name: TPO_174a.a

Status: done

Started: 2026-07-10 00:49:52
Settings
Chain sequence(s) A: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:32)
Show buried residues

Minimal score value
-2.8104
Maximal score value
3.3975
Average score
-0.539
Total score value
-93.7784

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -0.3215
2 P A -0.4162
3 A A -0.0991
4 P A -0.3927
5 P A -0.5077
6 A A 0.0000
7 C A 0.1364
8 D A -0.6087
9 L A -0.4769
10 R A -2.0033
11 V A -1.0738
12 L A 0.0000
13 S A -2.1138
14 K A -2.8104
15 L A 0.0000
16 L A -2.0027
17 R A -2.4836
18 D A -1.6116
19 S A 0.0000
20 H A -1.4300
21 V A -0.3290
22 L A 0.0000
23 H A -1.0088
24 S A -1.0835
25 R A -1.7520
26 L A 0.0000
27 S A -1.6005
28 Q A -2.0537
29 C A 0.0000
30 P A -1.4047
31 E A -2.1078
32 V A -1.2654
33 H A -1.3914
34 P A -1.5930
35 L A 0.0000
36 P A -0.8400
37 T A -0.4768
38 P A -0.6387
39 V A 0.0000
40 L A 0.8456
41 L A 0.0000
42 P A 0.0000
43 A A -1.0274
44 V A -1.0171
45 D A -1.5623
46 F A -0.7030
47 S A -0.8922
48 L A -0.3720
49 G A -1.5676
50 E A -2.4261
51 W A 0.0000
52 K A -2.2363
53 T A -1.6762
54 Q A -1.7052
55 M A -0.9509
56 E A -2.5376
57 E A -2.7350
58 T A -1.7868
59 K A -1.9368
60 A A 0.0000
61 Q A -2.2449
62 D A -2.3055
63 I A 0.0000
64 L A 0.0000
65 G A 0.0000
66 A A 0.0000
67 V A 0.0000
68 T A -0.8962
69 L A -0.6270
70 L A 0.0000
71 L A 0.0000
72 E A -1.4248
73 G A 0.0000
74 V A 0.0000
75 M A -0.6391
76 A A -0.5780
77 A A 0.0000
78 R A -1.4651
79 G A -1.0058
80 Q A -0.9523
81 L A -0.7925
82 G A -0.7991
83 P A -0.5253
84 T A -0.4390
85 C A -0.3958
86 L A 0.0000
87 S A 0.0000
88 S A -0.5647
89 L A 0.0000
90 L A 0.0000
91 G A -0.8254
92 Q A -1.0703
93 L A 0.0000
94 S A -1.1411
95 G A -1.0500
96 Q A -0.9289
97 V A 0.0000
98 R A -1.5078
99 L A 0.1077
100 L A 0.0000
101 L A -0.5539
102 G A -0.6397
103 A A -0.2943
104 L A 0.0000
105 Q A -0.8171
106 S A -0.5297
107 L A 0.0000
108 L A -0.5141
109 G A -0.6711
110 T A -0.8335
111 Q A -1.2704
112 L A -0.8634
113 P A -0.8240
114 P A -1.5594
115 Q A -2.1400
116 G A -2.2421
117 R A -2.2107
118 T A -0.6896
119 T A -0.0051
120 A A 0.1020
121 H A -0.8736
122 K A -1.8208
123 D A -2.0854
124 P A 0.0000
125 N A -0.8975
126 A A -0.5828
127 I A 0.0000
128 F A 0.0000
129 L A 0.1647
130 S A 0.0000
131 F A 0.0000
132 Q A 0.0000
133 H A -1.2605
134 L A 0.0000
135 L A 0.0000
136 R A -1.5987
137 G A -1.0150
138 K A 0.0000
139 V A 0.0000
140 R A -0.3675
141 F A 0.8643
142 L A 0.0000
143 M A 1.2584
144 L A 2.4043
145 V A 2.1117
146 G A 0.6348
147 G A 0.0000
148 S A 0.7898
149 T A 0.0400
150 L A 0.0095
151 C A 0.2152
152 V A 0.7090
153 R A -1.3011
154 R A -0.9744
155 A A -0.4598
156 P A -0.6821
157 P A -0.5798
158 T A -0.0004
159 T A 0.3360
160 A A 0.7277
161 V A 1.3308
162 P A 0.0530
163 S A -0.7976
164 R A -1.6904
165 T A -0.5753
166 S A 0.7068
167 L A 2.5759
168 V A 3.3975
169 L A 3.0044
170 T A 1.6776
171 L A 1.1945
172 N A -0.9278
173 E A -1.3182
174 L A 0.4992
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018