Project name: 5F7

Status: done

Started: 2026-07-20 06:59:31
Settings
Chain sequence(s) A: EVQLVESGGGLVQAGGSLRLSCAASGITFSINTMGWYRQAPGKQRELVALISSIGDTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCKRFRTAAQGTDYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)
Show buried residues

Minimal score value
-3.2205
Maximal score value
1.5383
Average score
-0.6972
Total score value
-82.2669

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.1757
2 V A -1.3304
3 Q A -1.2900
4 L A 0.0000
5 V A 1.0685
6 E A -0.0185
7 S A -0.5520
8 G A -1.2552
9 G A -0.8807
10 G A -0.0725
11 L A 1.0509
12 V A -0.0004
13 Q A -1.2436
14 A A -1.4275
15 G A -1.3110
16 G A -0.8693
17 S A -1.2262
18 L A -0.9165
19 R A -2.1537
20 L A 0.0000
21 S A -0.4339
22 C A 0.0000
23 A A -0.1892
24 A A 0.0000
25 S A -1.0693
26 G A -1.3232
27 I A -0.4275
28 T A 0.0467
29 F A 0.0000
30 S A 0.4107
31 I A 1.4227
32 N A 0.0000
33 T A 0.1035
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 Y A -0.3026
38 R A 0.0000
39 Q A -2.1624
40 A A -2.0129
41 P A -1.3874
42 G A -1.8687
43 K A -3.1866
44 Q A -3.2205
45 R A -2.9607
46 E A -2.2306
47 L A -0.2458
48 V A 0.0000
49 A A 0.0000
50 L A 0.5490
51 I A 0.0000
52 S A 0.3057
53 S A 0.7823
54 I A 1.5383
55 G A -0.1469
56 D A -1.1215
57 T A -0.0173
58 Y A 0.6865
59 Y A -0.0993
60 A A -0.9799
61 D A -2.3487
62 S A -1.7698
63 V A 0.0000
64 K A -2.4550
65 G A -1.7849
66 R A -1.5938
67 F A 0.0000
68 T A -0.6881
69 I A 0.0000
70 S A -0.6523
71 R A -1.1356
72 D A -1.6870
73 N A -1.8230
74 A A -1.5441
75 K A -2.3937
76 N A -1.8668
77 T A 0.0000
78 V A 0.0000
79 Y A -0.6348
80 L A 0.0000
81 Q A -1.3161
82 M A 0.0000
83 N A -1.5282
84 S A -1.2052
85 L A 0.0000
86 K A -2.1583
87 P A -1.7925
88 E A -2.2536
89 D A 0.0000
90 T A -0.9334
91 A A 0.0000
92 V A -0.7382
93 Y A 0.0000
94 Y A -0.2973
95 C A 0.0000
96 K A 0.0000
97 R A 0.0000
98 F A -0.5962
99 R A -1.8187
100 T A -0.8672
101 A A -0.5757
102 A A -0.5704
103 Q A -1.1446
104 G A -1.1550
105 T A -0.8571
106 D A -0.7493
107 Y A -0.0221
108 W A 0.3409
109 G A -0.0853
110 Q A -0.9200
111 G A -0.6053
112 T A -0.8154
113 Q A -1.1370
114 V A 0.0000
115 T A -0.3401
116 V A 0.0000
117 S A -0.7723
118 S A -0.8311
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018