Project name: query_structure

Status: done

Started: 2026-03-17 00:18:20
Settings
Chain sequence(s) A: QVQLAESGGGLVQAGGSLRLSCAASGFPVHHQYMAWYRQAPGKEREWVAAIASWGGGTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDTGSWWEWYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:24)
Show buried residues

Minimal score value
-3.6724
Maximal score value
1.3309
Average score
-0.7147
Total score value
-85.7598

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3775
2 V A -0.6499
3 Q A -1.2008
4 L A 0.0000
5 A A -0.4970
6 E A 0.0000
7 S A -0.9689
8 G A -1.0462
9 G A -0.8698
10 G A -0.0948
11 L A 0.9247
12 V A 0.0000
13 Q A -1.3220
14 A A -1.4548
15 G A -1.3532
16 G A -0.9095
17 S A -1.2185
18 L A -0.9250
19 R A -2.1276
20 L A 0.0000
21 S A -0.6681
22 C A 0.0000
23 A A -0.6598
24 A A 0.0000
25 S A -0.8851
26 G A -0.9283
27 F A -0.5686
28 P A -0.9801
29 V A 0.0000
30 H A -0.8277
31 H A -0.5237
32 Q A 0.0000
33 Y A -0.1808
34 M A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A -0.3947
38 R A -1.2901
39 Q A -2.1813
40 A A -2.1063
41 P A -1.4853
42 G A -1.9963
43 K A -3.4169
44 E A -3.6724
45 R A -2.9968
46 E A -1.7976
47 W A -0.4609
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 A A -0.0382
53 S A -0.0994
54 W A 0.5749
55 G A -0.2882
56 G A -0.2983
57 G A -0.2104
58 T A 0.2323
59 Y A 0.5904
60 Y A -0.3551
61 A A -1.0921
62 D A -2.3063
63 S A -1.7271
64 V A 0.0000
65 K A -2.4894
66 G A -1.7882
67 R A -1.4885
68 F A 0.0000
69 T A -0.7275
70 I A 0.0000
71 S A -0.5750
72 R A -1.2847
73 D A -1.9418
74 N A -2.3660
75 A A -1.7340
76 K A -2.4391
77 N A -1.8723
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6795
81 L A 0.0000
82 Q A -1.2199
83 M A 0.0000
84 N A -1.3763
85 S A -1.2000
86 L A 0.0000
87 K A -2.3797
88 P A -1.9552
89 E A -2.3601
90 D A 0.0000
91 T A -1.0175
92 A A 0.0000
93 V A -0.7527
94 Y A 0.0000
95 Y A -0.4099
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -1.2421
100 D A -0.7441
101 T A -0.2080
102 G A 0.1724
103 S A 0.4016
104 W A 1.3251
105 W A 1.3309
106 E A -0.2077
107 W A 0.5342
108 Y A 0.0976
109 D A -1.3545
110 Y A -0.4509
111 W A -0.2636
112 G A -0.4580
113 Q A -1.2948
114 G A -0.8115
115 T A 0.0000
116 Q A -1.2246
117 V A 0.0000
118 T A -0.3769
119 V A 0.0000
120 S A -0.7985
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018