Project name: query_structure

Status: done

Started: 2026-03-17 01:10:41
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGGSWYGWQEFAVPGSKSTATISGLKPGVDYTITVYAYPDHHYQGRSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:35)
Show buried residues

Minimal score value
-3.3504
Maximal score value
1.6666
Average score
-0.7421
Total score value
-69.0124

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.6666
2 S A 0.3608
3 D A -0.5150
4 V A -0.8329
5 P A 0.0000
6 R A -3.1000
7 D A -3.3504
8 L A 0.0000
9 E A -2.1124
10 V A 0.0968
11 V A 1.5468
12 A A 0.9034
13 A A 0.3202
14 T A -0.3381
15 P A -1.1165
16 T A -0.9976
17 S A -0.5282
18 L A 0.0000
19 L A 0.7560
20 I A 0.0000
21 S A -1.1260
22 W A 0.0000
23 D A -3.1872
24 A A -1.6231
25 P A 0.0000
26 A A 0.2553
27 V A 0.4587
28 T A -0.5354
29 V A -1.1797
30 D A -2.4538
31 Y A -1.2277
32 Y A 0.0000
33 V A 0.0671
34 I A 0.0000
35 T A 0.0000
36 Y A 0.0000
37 G A 0.0000
38 E A -1.6514
39 T A -1.1980
40 G A -0.8320
41 G A -0.5768
42 S A 0.3548
43 W A 1.3109
44 Y A 1.5228
45 G A 0.2916
46 W A -0.2367
47 Q A -1.2855
48 E A -1.8294
49 F A -0.4415
50 A A 0.0753
51 V A 0.0000
52 P A -1.0193
53 G A -1.2898
54 S A -1.3419
55 K A -2.1242
56 S A -1.3687
57 T A -0.7445
58 A A 0.0000
59 T A 0.2404
60 I A 0.0000
61 S A -0.6604
62 G A -1.0297
63 L A 0.0000
64 K A -2.3927
65 P A -1.6599
66 G A -1.4580
67 V A -1.4755
68 D A -2.1680
69 Y A 0.0000
70 T A -1.0587
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A -0.0883
75 A A 0.0000
76 Y A 0.0000
77 P A -1.9722
78 D A -2.9903
79 H A -2.4297
80 H A -1.9038
81 Y A -0.7348
82 Q A -1.8999
83 G A -1.7459
84 R A -2.0008
85 S A -1.2195
86 P A -0.7197
87 I A -0.4753
88 S A -0.6992
89 I A -0.7631
90 N A -1.7817
91 Y A -1.5283
92 R A -2.5710
93 T A -1.6498
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018