Project name: Mb5-11_I18L_I104L_VVFFLF_Lib2_Lib3_overlap

Status: done

Started: 2026-07-06 07:10:57
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTFTVYAVTWYPRYGYGESGPLSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)
Show buried residues

Minimal score value
-2.8127
Maximal score value
1.4907
Average score
-0.7254
Total score value
-79.0678

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4732
2 Q A -0.8055
3 A A -0.8160
4 N A -1.4303
5 S A -0.9695
6 G A -1.2187
7 S A -1.0755
8 L A -1.0176
9 E A -1.6998
10 V A -0.3168
11 V A 0.1879
12 E A -1.3290
13 A A -0.9956
14 S A -1.1976
15 P A -1.8707
16 T A -1.2243
17 S A -1.1000
18 L A 0.0000
19 Q A -0.7244
20 V A 0.0000
21 S A -1.0487
22 W A 0.0000
23 D A -2.4411
24 A A -1.4624
25 F A 0.0000
26 H A -1.0263
27 R A 0.0000
28 Y A 1.0992
29 H A 0.2711
30 N A -0.5934
31 G A 0.1264
32 F A 1.4907
33 T A 0.7239
34 H A 0.0725
35 P A -0.4017
36 V A -0.9713
37 R A -1.4920
38 Y A -0.8516
39 Y A 0.0000
40 R A -0.8509
41 V A 0.0000
42 T A 0.0000
43 Y A -0.4013
44 G A -0.7474
45 E A -1.6394
46 T A -1.2703
47 G A -1.2477
48 G A -1.4121
49 N A -1.5568
50 S A -0.9554
51 P A -0.4340
52 V A 0.2620
53 Q A -1.2264
54 E A -1.8026
55 F A -0.6732
56 T A -0.2068
57 V A -0.3760
58 P A -0.9171
59 G A -1.1738
60 S A -1.0933
61 K A -1.5976
62 S A -1.1020
63 T A -0.7160
64 A A 0.0000
65 T A -0.2813
66 F A 0.0000
67 S A -0.7624
68 G A -1.0082
69 L A 0.0000
70 K A -2.5125
71 P A -2.1500
72 G A -1.5646
73 V A -1.3378
74 D A -2.2406
75 Y A 0.0000
76 T A -0.8202
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2866
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6331
85 Y A 0.0000
86 P A -0.4586
87 R A -1.1209
88 Y A 0.6603
89 G A 0.5991
90 Y A 0.8947
91 G A 0.2443
92 E A -0.6851
93 S A 0.0000
94 G A -0.6367
95 P A -0.4315
96 L A -0.1216
97 S A -0.2588
98 F A -0.5145
99 N A -1.5877
100 Y A -1.4551
101 R A -2.6442
102 T A 0.0000
103 E A -2.2961
104 L A -1.4234
105 D A -2.7964
106 K A -2.8127
107 P A -1.8234
108 S A -1.6360
109 Q A -1.6594
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018