Project name: 170e3e80b352aad

Status: done

Started: 2025-03-10 14:33:41
Settings
Chain sequence(s) A: QPSRKEKSLGLLCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTWHGRHNLNKTLGTLKSIGEENKYAEQIMMIKKKNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHVEDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:12)
Show buried residues

Minimal score value
-4.4775
Maximal score value
1.2428
Average score
-1.0609
Total score value
-197.3296

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
110 Q A -2.3507
111 P A -1.8290
112 S A -2.7904
113 R A -4.0603
114 K A -4.0903
115 E A -4.1439
116 K A -3.6220
117 S A -2.4680
118 L A 0.0000
119 G A -0.7605
120 L A -0.6002
121 L A 0.0000
122 C A 0.0000
123 H A -0.7034
124 K A -1.2993
125 F A -0.5985
126 L A 0.0000
127 A A -0.6711
128 R A -0.9695
129 Y A -0.3695
130 P A -0.2968
131 N A -0.1439
132 Y A 0.4010
133 P A -0.5890
134 N A -1.1376
135 P A -0.6886
136 A A 0.2191
137 V A 1.2428
138 N A -0.2166
139 N A -0.4495
140 D A -0.7859
141 I A -0.4479
142 C A -0.2793
143 L A -0.0942
144 D A -1.6612
145 E A 0.0000
146 V A -0.6907
147 A A -0.9992
148 E A -2.3383
149 E A -1.5067
150 L A 0.4787
151 N A -0.5653
152 V A -0.8404
153 E A -1.4392
154 R A -1.8706
155 R A -2.5869
156 R A -1.9633
157 I A 0.0000
158 Y A -0.7415
159 D A -1.3852
160 I A 0.0000
161 V A -0.3782
162 N A -0.6035
163 V A 0.0000
164 L A 0.0000
165 E A 0.0000
166 S A 0.0000
167 L A 0.0000
168 H A -1.8559
169 M A 0.0000
170 V A 0.0000
171 S A -1.1201
172 R A -1.7286
173 L A -0.1362
174 A A -0.9286
175 K A -2.0112
176 N A -1.4183
177 R A -1.4194
178 Y A -1.0942
179 T A -0.6373
180 W A 0.0000
181 H A -1.5075
182 G A 0.0000
183 R A -1.3604
184 H A -1.8243
185 N A -2.0896
186 L A 0.0000
187 N A -1.9248
188 K A -2.6730
189 T A 0.0000
190 L A 0.0000
191 G A -1.4862
192 T A -0.9074
193 L A 0.0000
194 K A -1.8575
195 S A -0.4946
196 I A 0.7148
197 G A -1.4007
198 E A -2.7517
199 E A -3.4282
200 N A -3.5825
201 K A -3.6439
202 Y A 0.0000
203 A A -1.7288
204 E A -2.2615
205 Q A 0.0000
206 I A -0.3848
207 M A -0.1039
208 M A -0.0451
209 I A -0.4396
210 K A -2.0333
211 K A -2.7313
212 K A -2.4673
259 N A -2.6484
260 S A -3.2031
261 R A -3.9385
262 K A -4.4775
263 D A -4.4581
264 K A -4.1328
265 S A -1.8558
266 L A -1.1681
267 R A -1.2229
268 V A -0.6813
269 M A 0.0000
270 S A 0.0000
271 Q A -0.6077
272 K A -0.5935
273 F A 0.0000
274 V A 0.0000
275 M A 0.0000
276 L A 0.0000
277 F A -0.1722
278 L A 0.1419
279 V A 0.9184
280 S A 0.4102
281 T A 0.0453
282 P A -0.4325
283 Q A -0.6848
284 I A -0.0618
285 V A 0.0000
286 S A 0.1732
287 L A 0.3718
288 E A 0.0000
289 V A 0.0000
290 A A 0.8781
291 A A 0.0000
292 K A 0.0000
293 I A 0.0308
294 L A 0.4205
295 I A 0.9268
296 G A -0.4468
297 E A -1.4994
298 D A -2.1567
299 H A -1.7730
300 V A -0.3337
301 E A -2.5158
302 D A -3.1245
303 L A -1.6297
304 D A -3.3283
305 K A -3.0528
306 S A -2.4371
307 K A -2.5826
308 F A -1.6211
309 K A -3.0344
310 T A -2.1795
311 K A -1.8841
312 I A -1.7406
313 R A -2.8413
314 R A -2.6328
315 L A 0.0000
316 Y A -0.4228
317 D A -1.6326
318 I A 0.0000
319 A A -0.7823
320 N A -0.6066
321 V A 0.0000
322 L A 0.0000
323 S A -0.7145
324 S A 0.0000
325 L A 1.1858
326 D A -0.4414
327 L A 0.0000
328 I A 0.0000
329 K A -2.6214
330 K A -2.0855
331 V A -0.6075
332 H A -0.3396
333 V A 1.1197
334 T A 0.2651
335 E A -0.8745
336 E A -1.3922
337 R A -2.7383
338 G A -2.4180
339 R A -3.1009
340 K A -2.3233
341 P A -1.5152
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018