Project name: 17274bcd7d3832b

Status: done

Started: 2026-07-01 15:24:54
Settings
Chain sequence(s) B: AATSTRFVAMSWGPLEKTPQRVATATVQGAGLQAVSISVSGGTLTVTLRL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-1.7845
Maximal score value
2.8503
Average score
0.0607
Total score value
3.0365

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -0.0887
2 A B -0.3048
3 T B -0.6643
4 S B -1.0559
5 T B -1.1682
6 R B -1.6012
7 F B 0.1879
8 V B 0.6775
9 A B 1.2056
10 M B 0.6811
11 S B 0.2785
12 W B 0.3388
13 G B -0.0115
14 P B 0.1584
15 L B 0.6894
16 E B -0.9954
17 K B -1.7845
18 T B -1.2429
19 P B -0.9468
20 Q B -1.4127
21 R B -0.9757
22 V B 1.1842
23 A B 0.7990
24 T B 0.2156
25 A B -0.1150
26 T B -0.7736
27 V B -0.5425
28 Q B -1.2738
29 G B -0.4653
30 A B -0.2837
31 G B -0.5002
32 L B -0.4522
33 Q B -1.1209
34 A B 0.2312
35 V B 0.7422
36 S B 1.0784
37 I B 2.8503
38 S B 1.9187
39 V B 2.1853
40 S B 0.3798
41 G B -0.3240
42 G B -0.2449
43 T B 0.4123
44 L B 1.9306
45 T B 1.5342
46 V B 1.8867
47 T B 0.6195
48 L B 0.0876
49 R B -1.1359
50 L B 0.2483
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018