Project name: 17524e1392c1153

Status: done

Started: 2026-04-13 01:32:56
Settings
Chain sequence(s) A: SAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)
Show buried residues

Minimal score value
-3.6656
Maximal score value
0.425
Average score
-1.3901
Total score value
-76.454

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 S A -1.4776
6 A A -1.2123
7 V A 0.0000
8 K A -1.1450
9 A A 0.0000
10 L A -0.4452
11 F A -0.3687
12 D A -2.1085
13 Y A 0.0000
14 K A -2.5356
15 A A -2.3979
16 Q A -3.0188
17 R A -3.6656
18 E A -3.1672
19 D A -2.3747
20 E A 0.0000
21 L A 0.0000
22 T A -1.2411
23 F A 0.0000
24 T A -1.5042
25 K A -1.6718
26 S A -0.8851
27 A A 0.0000
28 I A 0.4250
29 I A 0.0000
30 Q A -1.5670
31 N A -2.3271
32 V A -2.2661
33 E A -3.1025
34 K A -3.3319
35 Q A -3.2584
36 D A -2.8595
37 G A -1.7949
38 G A -1.3754
39 W A -1.0916
40 W A -1.7473
41 R A -2.0039
42 G A 0.0000
43 D A -1.7907
44 Y A -0.7979
45 G A -0.8675
46 G A -1.3489
47 K A -1.8406
48 K A -2.6204
49 Q A -1.9610
50 L A -1.1578
51 W A -0.8657
52 F A 0.0000
53 P A 0.0000
54 S A -1.2467
55 N A -1.0872
56 Y A -0.6337
57 V A 0.0000
58 E A -2.2565
59 E A -2.4595
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018