Project name: query_structure

Status: done

Started: 2026-03-16 20:38:57
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGWTQPFIQSWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVSLRPYWYSGTLQVEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:46)
Show buried residues

Minimal score value
-3.2135
Maximal score value
1.8379
Average score
-0.6463
Total score value
-65.9255

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.0900
2 Q A -1.2571
3 V A 0.0000
4 D A -1.3849
5 I A 0.0000
6 V A 0.6304
7 P A 0.0966
8 S A -0.8335
9 Q A -1.9346
10 G A 0.0000
11 E A -2.7181
12 I A 0.0000
13 S A -1.1121
14 V A -0.2088
15 G A -1.3706
16 E A -2.4037
17 S A -1.1840
18 K A -0.5510
19 F A 1.8379
20 F A 0.0000
21 L A 0.7958
22 C A 0.0000
23 Q A -1.3698
24 V A 0.0000
25 A A -0.5770
26 G A -0.3528
27 W A -0.0444
28 T A -0.3027
29 Q A -0.5921
30 P A -0.4189
31 F A 0.3161
32 I A 1.4788
33 Q A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.3341
37 S A -1.3469
38 P A -1.3232
39 N A -2.0870
40 G A -2.2272
41 E A -3.2135
42 K A -2.7612
43 L A -1.6626
44 T A -1.2198
45 P A -0.9223
46 N A -2.2528
47 Q A -2.5810
48 Q A -2.4676
49 R A -1.9294
50 I A 0.0000
51 S A -0.4195
52 V A 0.0000
53 V A 0.9249
54 W A -0.1480
55 N A -1.7764
56 D A -2.9739
57 D A -2.6843
58 S A -1.6255
59 S A -1.4181
60 S A 0.0000
61 T A 0.7759
62 L A 0.0000
63 T A 0.7949
64 I A 0.0000
65 Y A -0.8648
66 N A -2.1151
67 A A 0.0000
68 N A -1.2843
69 I A -0.1125
70 D A -1.6276
71 D A 0.0000
72 A A -0.8613
73 G A -0.4337
74 I A 0.2202
75 Y A 0.0000
76 K A -1.1605
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 S A -0.1507
81 L A 0.0000
82 R A -1.1114
83 P A 0.0000
84 Y A 1.5748
85 W A 1.8232
86 Y A 1.1918
87 S A 0.2941
88 G A -0.1656
89 T A -0.6995
90 L A -0.3673
91 Q A -1.0789
92 V A -1.0682
93 E A -2.1018
94 A A -1.3674
95 T A -0.7731
96 V A 0.0000
97 N A -1.5154
98 V A 0.0000
99 K A -2.1316
100 I A 0.0000
101 F A -0.3368
102 Q A -0.4530
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018