Project name: query_structure

Status: done

Started: 2026-03-16 23:22:12
Settings
Chain sequence(s) A: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:40)
Show buried residues

Minimal score value
-4.7714
Maximal score value
2.4593
Average score
-1.1708
Total score value
-52.6868

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A 0.8628
2 I A 2.4593
3 I A 2.2965
4 N A 0.0516
5 T A -0.0771
6 L A -0.3766
7 Q A -2.0063
8 K A -2.0305
9 Y A -0.7364
10 Y A -0.6797
11 C A -1.8070
12 R A -1.7937
13 V A -0.3445
14 R A -1.7253
15 G A -2.0492
16 G A -2.2971
17 R A -1.9503
18 C A -0.3044
19 A A 0.0000
20 V A 2.2002
21 L A 1.6819
22 S A 0.6474
23 C A -0.4425
24 L A -0.8793
25 P A -1.6747
26 K A -3.2215
27 E A 0.0000
28 E A -3.2746
29 Q A -2.7990
30 I A 0.0000
31 G A 0.0000
32 K A -3.2743
33 C A -1.9836
34 S A -1.4488
35 T A -2.0346
36 R A -2.5859
37 G A -1.4053
38 R A -1.2165
39 K A -1.9826
40 C A 0.0000
41 C A 0.0000
42 R A -4.0400
43 R A -4.7714
44 K A -4.3790
45 K A -3.2948
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018