Project name: 179b4310b978f1e

Chain sequence(s)	A: ECSKLNLAVPVAVTIRITNTTVMSVRNPLADVPHINRSNNSLTIAMPPLVRPTHTRRNWLQQLLRPLPLSVADKPFQLPGLLPDLIRWLASRERWVRSLLPIKFQLLQLTIRILRPLLHRRHHRLKPRRSFPRFN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:26)

• Minimal score value: -3.6974
• Maximal score value: 2.6858
• Average score: -0.0665
• Total score value: -8.9839

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.7078
2	C	A	-0.4457
3	S	A	-0.8073
4	K	A	-1.2380
5	L	A	0.6057
6	N	A	-0.0683
7	L	A	1.6646
8	A	A	1.6337
9	V	A	2.4290
10	P	A	1.8610
11	V	A	2.6175
12	A	A	2.1091
13	V	A	2.5336
14	T	A	1.7204
15	I	A	2.1102
16	R	A	0.0804
17	I	A	1.2902
18	T	A	-0.0179
19	N	A	-0.8091
20	T	A	0.0146
21	T	A	0.6558
22	V	A	2.2506
23	M	A	1.9993
24	S	A	0.9693
25	V	A	0.9602
26	R	A	-1.4140
27	N	A	-1.5612
28	P	A	-0.6552
29	L	A	0.6056
30	A	A	-0.1939
31	D	A	-0.8768
32	V	A	1.0588
33	P	A	0.0860
34	H	A	-0.4614
35	I	A	0.7721
36	N	A	-1.5243
37	R	A	-2.4164
38	S	A	-1.9634
39	N	A	-2.4865
40	N	A	-2.0128
41	S	A	-0.4450
42	L	A	1.2992
43	T	A	1.6085
44	I	A	2.6858
45	A	A	1.5908
46	M	A	1.7148
47	P	A	1.0531
48	P	A	0.9038
49	L	A	1.8652
50	V	A	1.4796
51	R	A	-0.8576
52	P	A	-0.7414
53	T	A	-1.1111
54	H	A	-2.2186
55	T	A	-2.1191
56	R	A	-2.9249
57	R	A	-3.0713
58	N	A	-2.2332
59	W	A	0.0028
60	L	A	0.6562
61	Q	A	-0.8263
62	Q	A	-0.2761
63	L	A	1.5996
64	L	A	1.3571
65	R	A	-0.7178
66	P	A	0.3072
67	L	A	1.6029
68	P	A	1.0974
69	L	A	2.2499
70	S	A	1.3337
71	V	A	1.1764
72	A	A	-0.2190
73	D	A	-1.8828
74	K	A	-1.9554
75	P	A	-0.6587
76	F	A	1.0146
77	Q	A	0.0798
78	L	A	1.7049
79	P	A	0.7426
80	G	A	0.2445
81	L	A	1.2165
82	L	A	2.0953
83	P	A	0.9688
84	D	A	0.4601
85	L	A	2.0391
86	I	A	2.2865
87	R	A	-0.0686
88	W	A	1.1256
89	L	A	1.0851
90	A	A	-0.2152
91	S	A	-0.9081
92	R	A	-1.9921
93	E	A	-2.4504
94	R	A	-2.7201
95	W	A	-0.9786
96	V	A	-1.0971
97	R	A	-2.0129
98	S	A	-0.8914
99	L	A	0.2972
100	L	A	0.8535
101	P	A	0.8742
102	I	A	1.3852
103	K	A	0.6834
104	F	A	2.1047
105	Q	A	1.1134
106	L	A	1.8109
107	L	A	1.9650
108	Q	A	0.7392
109	L	A	0.9902
110	T	A	1.1994
111	I	A	0.5037
112	R	A	-0.6516
113	I	A	1.0466
114	L	A	0.4566
115	R	A	-1.2816
116	P	A	-1.1542
117	L	A	-0.4377
118	L	A	-0.8579
119	H	A	-2.9206
120	R	A	-3.6974
121	R	A	-3.5782
122	H	A	-3.3625
123	H	A	-3.6530
124	R	A	-3.5411
125	L	A	-1.7346
126	K	A	-2.8080
127	P	A	-2.5505
128	R	A	-2.8948
129	R	A	-2.6428
130	S	A	-1.0736
131	F	A	0.7289
132	P	A	-0.1226
133	R	A	-0.9512
134	F	A	0.6105
135	N	A	-0.8549