Project name: query_structure

Status: done

Started: 2026-03-16 22:55:02
Settings
Chain sequence(s) A: ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-3.2274
Maximal score value
1.7867
Average score
-0.9102
Total score value
-42.7801

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.2106
2 T A -0.8105
3 C A -0.9777
4 K A -2.1709
5 A A -1.2693
6 E A -1.7709
7 C A 0.0000
8 P A -0.7613
9 T A -0.6959
10 W A -0.9607
11 D A -1.6600
12 S A 0.0359
13 V A 1.7554
14 C A 0.0000
15 I A 1.4751
16 N A -0.6198
17 K A -1.8889
18 K A -2.2291
19 P A -1.2157
20 C A 0.0000
21 V A -1.8151
22 A A -1.7362
23 C A 0.0000
24 C A 0.0000
25 K A -3.2274
26 K A -2.9591
27 A A -2.3340
28 K A -2.9243
29 F A -2.3777
30 S A -1.9449
31 D A -2.3274
32 G A 0.0000
33 H A -2.2512
34 C A 0.0000
35 S A 0.0000
36 K A -0.6053
37 I A 1.7867
38 L A 1.7235
39 R A 0.4659
40 R A -0.4028
41 C A 0.0000
42 L A -1.2831
43 C A 0.0000
44 T A -2.0365
45 K A -2.2100
46 E A -1.9572
47 C A -0.3891
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018