Project name: 14_rank

Status: done

Started: 2026-04-29 08:03:51
Settings
Chain sequence(s) B: ATPAISPGMLDLVRFAVEEAEWYFERHGGPERGTPQFEWHVYSIARHLHDVERSLVLEALRVLEAE
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)
Show buried residues

Minimal score value
-3.7293
Maximal score value
0.4323
Average score
-1.2994
Total score value
-85.7591

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B 0.0106
2 T B -0.5062
3 P B -0.3898
4 A B -0.0800
5 I B -0.0546
6 S B -0.5152
7 P B -1.0997
8 G B -1.2367
9 M B -0.7154
10 L B -1.2765
11 D B -2.1801
12 L B -1.0418
13 V B 0.0000
14 R B -2.5819
15 F B -0.9767
16 A B 0.0000
17 V B 0.0000
18 E B -2.1042
19 E B -0.9226
20 A B 0.0000
21 E B -2.0902
22 W B -0.4487
23 Y B -0.4432
24 F B -2.1768
25 E B -3.0219
26 R B -2.9502
27 H B -2.3428
28 G B -2.1953
29 G B -2.0858
30 P B -2.4652
31 E B -3.5865
32 R B -3.7293
33 G B -2.4656
34 T B -1.7132
35 P B -1.2189
36 Q B -1.6087
37 F B 0.0000
38 E B -0.8616
39 W B 0.4323
40 H B -0.1956
41 V B 0.0000
42 Y B -0.6712
43 S B -0.6040
44 I B -0.2633
45 A B 0.0000
46 R B -3.2318
47 H B -1.8100
48 L B -0.6307
49 H B -2.2683
50 D B -3.0410
51 V B -2.4258
52 E B -2.9599
53 R B -2.2240
54 S B -1.2186
55 L B -0.4501
56 V B 0.0000
57 L B -0.7151
58 E B -1.0863
59 A B 0.0000
60 L B 0.0000
61 R B -1.9150
62 V B 0.0000
63 L B -2.1758
64 E B -2.9563
65 A B -1.8784
66 E B -2.3955
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018