Project name: query_structure

Status: done

Started: 2026-03-17 00:48:18
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVYSTWMRWYRQAPGKEREWVAAIESTGYTTWYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDYGWSWLAYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:15)
Show buried residues

Minimal score value
-3.5691
Maximal score value
2.1332
Average score
-0.4647
Total score value
-55.7615

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4929
2 V A -0.9754
3 Q A -0.9250
4 L A 0.0000
5 V A 1.1301
6 E A 0.0000
7 S A -0.5610
8 G A -1.0381
9 G A -0.8364
10 G A -0.0696
11 L A 1.0115
12 V A -0.0306
13 Q A -1.2649
14 A A -1.4861
15 G A -1.3941
16 G A -0.9103
17 S A -1.2384
18 L A -0.9255
19 R A -2.1323
20 L A 0.0000
21 S A -0.3558
22 C A 0.0000
23 A A -0.0654
24 A A 0.0000
25 S A -0.6388
26 G A -1.0351
27 F A -0.3438
28 P A -0.2330
29 V A 0.0000
30 Y A 0.7104
31 S A 0.3458
32 T A 0.0000
33 W A 0.1433
34 M A 0.0000
35 R A -0.0505
36 W A 0.0000
37 Y A -0.4675
38 R A -1.2517
39 Q A -2.1095
40 A A 0.0000
41 P A -1.4638
42 G A -1.9704
43 K A -3.3726
44 E A -3.5691
45 R A -2.7902
46 E A -1.7677
47 W A -0.4850
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 E A 0.1942
53 S A 0.2932
54 T A 0.2285
55 G A 0.2395
56 Y A 1.0789
57 T A 0.7248
58 T A 0.7561
59 W A 0.7817
60 Y A -0.2879
61 A A 0.0000
62 D A -2.2747
63 S A -1.7234
64 V A 0.0000
65 K A -2.4685
66 G A -1.8071
67 R A -1.5532
68 F A 0.0000
69 T A -0.7291
70 I A 0.0000
71 S A -0.3841
72 R A -0.8408
73 D A -1.6137
74 N A -1.6168
75 A A -1.3759
76 K A -2.3428
77 N A -1.4350
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6331
81 L A 0.0000
82 Q A -1.2341
83 M A 0.0000
84 N A -1.4982
85 S A -1.3016
86 L A 0.0000
87 K A -2.5430
88 P A -2.0075
89 E A -2.4126
90 D A 0.0000
91 T A -1.0261
92 A A 0.0000
93 V A -0.6959
94 Y A 0.0000
95 Y A -0.2057
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -0.3561
100 D A 0.4663
101 Y A 1.6982
102 G A 1.4005
103 W A 1.7364
104 S A 1.5021
105 W A 2.1332
106 L A 1.7947
107 A A 1.1507
108 Y A 0.6155
109 D A -0.7272
110 Y A -0.3276
111 W A 0.0383
112 G A 0.0036
113 Q A -0.9332
114 G A 0.0000
115 T A 0.0000
116 Q A -1.2074
117 V A 0.0000
118 T A -0.3440
119 V A 0.0000
120 S A -0.7822
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018