Project name: DAW1binder

Chain sequence(s)	A: EEEEKKKLEERIKKYVEETGPPEGVPKEEYIKRLLEELLKQKEIYDRLLERGGNQSRN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)

• Minimal score value: -5.4446
• Maximal score value: 0.0
• Average score: -2.8311
• Total score value: -164.2064

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-4.4303
2	E	A	-4.9856
3	E	A	-5.2822
4	E	A	-5.4446
5	K	A	-5.0541
6	K	A	-5.3952
7	K	A	-4.7758
8	L	A	-3.8830
9	E	A	-4.2581
10	E	A	-4.6769
11	R	A	-4.2950
12	I	A	0.0000
13	K	A	-4.1685
14	K	A	-4.0621
15	Y	A	-2.2801
16	V	A	0.0000
17	E	A	-3.6847
18	E	A	-3.0395
19	T	A	-1.5593
20	G	A	-1.8927
21	P	A	-1.6938
22	P	A	-1.2629
23	E	A	-2.1746
24	G	A	-1.3743
25	V	A	-1.2229
26	P	A	-1.7102
27	K	A	-2.9796
28	E	A	-3.4074
29	E	A	-2.9385
30	Y	A	-2.3955
31	I	A	-3.2987
32	K	A	-4.0030
33	R	A	-3.5409
34	L	A	-2.4106
35	L	A	0.0000
36	E	A	-3.5908
37	E	A	-3.6308
38	L	A	-2.1882
39	L	A	-2.5212
40	K	A	-3.1355
41	Q	A	-2.5698
42	K	A	-2.7624
43	E	A	-2.8112
44	I	A	-0.5249
45	Y	A	-1.1800
46	D	A	-2.9398
47	R	A	-2.8234
48	L	A	-1.1597
49	L	A	-1.5894
50	E	A	-3.2551
51	R	A	-3.1533
52	G	A	-2.1436
53	G	A	-1.9503
54	N	A	-2.1966
55	Q	A	-2.6647
56	S	A	-2.3791
57	R	A	-3.0852
58	N	A	-2.3708