Project name: VHL_N78Y

Chain sequence(s)	A: MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVYQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:07)

• Minimal score value: -4.0859
• Maximal score value: 1.8614
• Average score: -1.0483
• Total score value: -167.7316

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.1280
2	E	A	-1.7391
3	A	A	-1.2624
4	G	A	-2.1189
5	R	A	-2.9802
6	P	A	-2.0695
7	R	A	-2.6595
8	P	A	-1.4902
9	V	A	-0.4060
10	L	A	0.0000
11	R	A	-0.7784
12	S	A	0.0000
13	V	A	0.6923
14	N	A	-1.0145
15	S	A	-1.6841
16	R	A	-2.6915
17	E	A	-2.4692
18	P	A	-1.7491
19	S	A	0.0000
20	Q	A	-1.3032
21	V	A	0.0000
22	I	A	-0.6255
23	F	A	0.0000
24	C	A	-1.1139
25	N	A	0.0000
26	R	A	-2.2687
27	S	A	0.0000
28	P	A	-0.9981
29	R	A	-1.0149
30	V	A	-0.2279
31	V	A	0.0000
32	L	A	0.0312
33	P	A	0.0000
34	V	A	0.0000
35	W	A	-0.2963
36	L	A	0.0000
37	N	A	-1.0542
38	F	A	-0.7206
39	D	A	-2.2171
40	G	A	-1.7792
41	E	A	-2.6440
42	P	A	-1.5344
43	Q	A	-0.9730
44	P	A	-0.4372
45	Y	A	0.1748
46	P	A	-0.1572
47	T	A	0.0074
48	L	A	0.0000
49	P	A	-0.6130
50	P	A	-1.1023
51	G	A	-1.2939
52	T	A	-0.9949
53	G	A	-1.5114
54	R	A	-1.8446
55	R	A	-2.3005
56	I	A	-1.4688
57	H	A	-1.5380
58	S	A	0.0000
59	Y	A	-1.2603
60	R	A	-1.5882
61	G	A	-0.1963
62	H	A	0.0000
63	L	A	0.0000
64	W	A	0.0000
65	L	A	0.0000
66	F	A	0.0000
67	R	A	0.0000
68	D	A	0.0000
69	A	A	-0.3763
70	G	A	-0.6169
71	T	A	-0.9221
72	H	A	-1.0609
73	D	A	-0.9452
74	G	A	-0.4103
75	L	A	0.0000
76	L	A	0.1644
77	V	A	0.0000
78	Y	A	0.6805
79	Q	A	-0.6247
80	T	A	-0.3372
81	E	A	-0.4261
82	L	A	0.4266
83	F	A	0.0000
84	V	A	1.5485
85	P	A	0.0000
86	S	A	0.0891
87	L	A	-0.1018
88	N	A	-0.4577
89	V	A	0.4773
90	D	A	-1.5099
91	G	A	-1.3895
92	Q	A	-1.3412
93	P	A	-0.5568
94	I	A	0.5249
95	F	A	0.8834
96	A	A	0.0000
97	N	A	-0.5062
98	I	A	0.0000
99	T	A	-0.4059
100	L	A	0.3461
101	P	A	0.9035
102	V	A	1.8614
103	Y	A	0.5120
104	T	A	0.0944
105	L	A	0.3994
106	K	A	-1.2720
107	E	A	-1.5386
108	R	A	-1.3815
109	C	A	-0.5026
110	L	A	0.0000
111	Q	A	-0.4746
112	V	A	0.4647
113	V	A	0.5547
114	R	A	-0.3644
115	S	A	0.4971
116	L	A	1.3491
117	V	A	-0.4389
118	K	A	-2.1934
119	P	A	-2.8046
120	E	A	-3.6499
121	N	A	-3.3907
122	Y	A	0.0000
123	R	A	-3.9607
124	R	A	-3.4524
125	L	A	-1.8541
126	D	A	-1.9001
127	I	A	-0.0757
128	V	A	0.7912
129	R	A	-1.6299
130	S	A	-0.8426
131	L	A	-1.1404
132	Y	A	0.0000
133	E	A	-3.6980
134	D	A	-3.0126
135	L	A	0.0000
136	E	A	-4.0859
137	D	A	-3.7389
138	H	A	-2.8769
139	P	A	-2.1529
140	N	A	-2.5655
141	V	A	-2.1444
142	Q	A	-3.2368
143	K	A	-3.6965
144	D	A	-2.9083
145	L	A	0.0000
146	E	A	-3.9209
147	R	A	-3.7396
148	L	A	-2.6053
149	T	A	-2.5087
150	Q	A	-3.1832
151	E	A	-3.5431
152	R	A	-3.3980
153	I	A	-1.8279
154	A	A	-2.2382
155	H	A	-3.0250
156	Q	A	-3.3065
157	R	A	-2.9571
158	M	A	-1.2305
159	G	A	-2.0299
160	D	A	-2.6570