Project name: prot

Status: done

Started: 2026-05-21 13:51:05
Settings
Chain sequence(s) A: NPRGVAYIINNKNFARFSGMPKRNGTDVDARALNKLWTDFGFKTKTFTDVSGYDMRQNLRSLAKQDHSDYDCVIVSILTHGVEGKLYASDGELVPVEELIQLFNAGEVHKSLIGKPRLFFLQACRGDYFDKGVDQPDGGALALKMLEDYDFTDGKLQSLPSQADMFIGYATIPGYVSWRNSERGAWFVQGIVNVFTRFADSEHLADLNDRVNRYVAIEVEHPATTSKSHP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:54)
Show buried residues

Minimal score value
-3.6248
Maximal score value
1.6481
Average score
-0.8816
Total score value
-202.7679

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A -2.2596
2 P A -2.4547
3 R A -3.0925
4 G A 0.0000
5 V A 0.0000
6 A A 0.0000
7 Y A 0.0000
8 I A 0.0000
9 I A 0.0000
10 N A 0.0000
11 N A 0.0000
12 K A -1.7514
13 N A -1.7804
14 F A 0.0000
15 A A -1.0397
16 R A -1.3568
17 F A 0.8164
18 S A -0.0662
19 G A -0.5122
20 M A -0.6392
21 P A -1.6232
22 K A -2.6048
23 R A 0.0000
24 N A -2.8436
25 G A -2.3949
26 T A 0.0000
27 D A -1.8520
28 V A -0.9965
29 D A 0.0000
30 A A 0.0000
31 R A -2.2653
32 A A -1.3002
33 L A 0.0000
34 N A -2.1745
35 K A -2.6150
36 L A 0.0000
37 W A 0.0000
38 T A -2.2428
39 D A -2.4075
40 F A -1.6616
41 G A -1.9975
42 F A 0.0000
43 K A -2.4165
44 T A -1.7388
45 K A -1.6269
46 T A -0.8140
47 F A -0.3274
48 T A -0.5050
49 D A -0.9755
50 V A 0.0000
51 S A -0.5044
52 G A 0.0000
53 Y A 0.5251
54 D A -0.6641
55 M A 0.0000
56 R A -0.9095
57 Q A -1.0696
58 N A -0.9843
59 L A 0.0000
60 R A -2.8277
61 S A -1.9528
62 L A 0.0000
63 A A 0.0000
64 K A -3.3181
65 Q A -2.6190
66 D A -3.0599
67 H A 0.0000
68 S A -2.1480
69 D A -3.0011
70 Y A -2.8514
71 D A -2.9594
72 C A 0.0000
73 V A 0.0000
74 I A 0.0000
75 V A 0.0000
76 S A 0.0000
77 I A 0.0000
78 L A 0.0000
79 T A 0.0000
80 H A -0.1858
81 G A -0.1049
82 V A -0.4707
83 E A -1.5087
84 G A -1.4166
85 K A -1.2671
86 L A 0.0000
87 Y A -0.0698
88 A A 0.0000
89 S A -1.0963
90 D A -0.8725
91 G A -0.6118
92 E A -0.6285
93 L A 0.0341
94 V A 0.0000
95 P A -1.2336
96 V A 0.0000
97 E A -2.6065
98 E A -2.0952
99 L A 0.0000
100 I A 0.0000
101 Q A -2.4780
102 L A -1.9215
103 F A 0.0000
104 N A 0.0000
105 A A -1.3615
106 G A -1.5548
107 E A -2.4536
108 V A 0.0000
109 H A -2.6550
110 K A -2.5058
111 S A -2.0412
112 L A 0.0000
113 I A -0.5507
114 G A -0.7199
115 K A -1.0093
116 P A -0.8434
117 R A 0.0000
118 L A 0.3359
119 F A 0.0000
120 F A 0.0000
121 L A 0.0000
122 Q A 0.0000
123 A A 0.0000
124 C A 0.0969
125 R A -0.4031
126 G A -0.4124
127 D A -1.0122
128 Y A 0.6785
129 F A 0.7770
130 D A -0.7585
131 K A -1.8929
132 G A -1.4461
133 V A -0.3426
134 D A -2.0667
135 Q A -2.2776
136 P A -2.0897
137 D A -2.7292
138 G A -1.5496
139 G A -0.3968
140 A A 0.2832
141 L A 1.5625
142 A A 1.4955
143 L A 1.5684
144 K A -0.3456
145 M A 1.0038
146 L A 0.7429
147 E A -1.6948
148 D A -1.8458
149 Y A 0.1661
150 D A -1.1086
151 F A 0.4569
152 T A -0.6994
153 D A -2.2788
154 G A -1.6340
155 K A -1.8966
156 L A -0.2881
157 Q A -1.3008
158 S A -0.5286
159 L A -0.2886
160 P A -0.8656
161 S A -1.1801
162 Q A -1.4802
163 A A -0.9548
164 D A -1.1614
165 M A -0.3376
166 F A 0.4840
167 I A 1.0356
168 G A 0.0000
169 Y A 0.7334
170 A A 0.5375
171 T A 1.0002
172 I A 1.6481
173 P A 0.3855
174 G A -0.0342
175 Y A 0.7057
176 V A 0.6146
177 S A 0.6274
178 W A 0.2714
179 R A -1.6906
180 N A -2.6182
181 S A -2.6044
182 E A -3.3583
183 R A -3.2187
184 G A 0.0000
185 A A 0.0000
186 W A -0.3882
187 F A 0.0000
188 V A 0.0000
189 Q A -0.2936
190 G A 0.0000
191 I A 0.0000
192 V A -0.3152
193 N A -0.6486
194 V A 0.0000
195 F A 0.0000
196 T A -1.2495
197 R A -2.0115
198 F A -1.5029
199 A A -1.5260
200 D A -2.2671
201 S A -1.6567
202 E A -1.7760
203 H A -1.7106
204 L A -0.9812
205 A A -1.4367
206 D A -2.6351
207 L A 0.0000
208 N A -2.3316
209 D A -3.6248
210 R A -3.0740
211 V A 0.0000
212 N A -2.9293
213 R A -2.8463
214 Y A -1.2538
215 V A -0.8315
216 A A -0.9644
217 I A -0.4689
218 E A -0.7628
219 V A -0.7527
220 E A -2.1103
221 H A -1.7217
222 P A -1.0441
223 A A -0.6533
224 T A -0.6201
225 T A -0.7613
226 S A -1.2897
227 K A -2.2576
228 S A -1.6694
229 H A -1.7368
230 P A -0.9918
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018