Project name: query_structure

Status: done

Started: 2026-03-17 00:36:31
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLLLSCAASGFPVSETYMEWYRQAPGKEREWVAAINSWGWYTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVEVGEWYYGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:21)
Show buried residues

Minimal score value
-3.8891
Maximal score value
2.4543
Average score
-0.61
Total score value
-69.5432

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4168
2 V A -0.6029
3 Q A -1.1045
4 L A 0.0000
5 V A 0.5207
6 E A 0.0000
7 S A -0.2731
8 G A -0.1796
9 G A -0.3097
10 G A 0.1760
11 L A 0.9211
12 V A 0.0000
13 Q A -1.3305
14 A A -1.4761
15 G A -1.3785
16 G A -0.9318
17 S A -0.6155
18 L A 0.4844
19 L A 0.8220
20 L A 0.0000
21 S A 0.2499
22 C A 0.0000
23 A A -0.2782
24 A A 0.0000
25 S A -0.6900
26 G A -0.8865
27 F A -0.6436
28 P A -1.2596
29 V A 0.0000
30 S A -1.1454
31 E A -1.5286
32 T A -0.4542
33 Y A 0.7524
34 M A 0.0000
35 E A 0.1759
36 W A 0.0000
37 Y A -0.3650
38 R A -1.3694
39 Q A -2.3357
40 A A -2.1800
41 P A -1.5144
42 G A -2.0486
43 K A -3.5164
44 E A -3.8891
45 R A -3.3960
46 E A -1.9925
47 W A -0.5531
48 V A 0.0000
49 A A 0.0000
50 A A 0.8895
51 I A 0.0000
52 N A 1.1520
53 S A 0.3160
54 W A 1.2975
55 G A 0.9427
56 W A 2.0731
57 Y A 2.4543
58 T A 1.7412
59 Y A 1.2457
60 Y A -0.2250
61 A A -1.0182
62 D A -2.2650
63 S A -1.7675
64 V A 0.0000
65 K A -2.4293
66 G A -1.7693
67 R A -1.4705
68 F A 0.0000
69 T A -0.3346
70 I A 0.0000
71 S A -0.4191
72 R A -1.1034
73 D A -1.9488
74 N A -2.4421
75 A A -1.7299
76 K A -2.4522
77 N A -1.8285
78 T A -1.1554
79 V A 0.0000
80 Y A 0.0624
81 L A 0.0000
82 Q A -0.0703
83 M A 0.0000
84 N A -1.0192
85 S A -1.2343
86 L A 0.0000
87 K A -2.4224
88 P A -2.0061
89 E A -2.3862
90 D A 0.0000
91 T A -1.0382
92 A A 0.0000
93 V A -0.7752
94 Y A 0.0000
95 Y A -0.2746
96 C A 0.0000
97 A A 0.0000
98 V A 0.0000
99 E A -1.5777
100 V A -0.8296
101 G A -1.3558
102 E A -2.0332
103 W A -0.6532
104 Y A -0.1264
105 Y A 0.2664
106 G A -0.1603
107 Q A -1.0629
108 G A -0.6116
109 T A 0.0000
110 Q A -1.2194
111 V A 0.0000
112 T A -0.3895
113 V A 0.0000
114 S A -0.8162
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018