Project name: query_structure

Status: done

Started: 2026-03-16 21:45:49
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSISYRERSAWGEAIALVVPGSERSYDLTGLKPGIEYIVGIIGVKGGLRSNPLRADFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)
Show buried residues

Minimal score value
-3.0363
Maximal score value
1.9313
Average score
-0.9221
Total score value
-82.9869

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7939
2 L A 0.1560
3 P A -0.6748
4 A A -1.0550
5 P A 0.0000
6 K A -2.1829
7 N A -1.4641
8 L A -0.5690
9 V A 0.7427
10 V A 0.0870
11 S A -0.6457
12 R A -2.0734
13 V A -1.1445
14 T A -1.8470
15 E A -3.0363
16 D A -2.7958
17 S A -2.1518
18 A A 0.0000
19 R A -1.2397
20 L A 0.0000
21 S A -0.3070
22 W A 0.0000
23 T A -1.2560
24 A A -1.4144
25 P A -1.4063
26 D A -2.2716
27 A A -1.4281
28 A A -1.1631
29 F A 0.0000
30 D A -2.3682
31 S A -1.1037
32 F A 0.0000
33 S A 0.6955
34 I A 0.0000
35 S A 0.1926
36 Y A -0.7036
37 R A -1.4199
38 E A -2.1503
39 R A -2.5630
40 S A -1.1902
41 A A -0.8036
42 W A 0.1287
43 G A -0.9372
44 E A -1.6306
45 A A -0.7206
46 I A 0.2890
47 A A 0.7264
48 L A 1.4566
49 V A 1.9313
50 V A 0.0000
51 P A -0.7329
52 G A 0.0000
53 S A -1.6379
54 E A -1.7626
55 R A -1.1911
56 S A -0.6575
57 Y A -0.7341
58 D A -1.6731
59 L A 0.0000
60 T A -1.3804
61 G A -1.5326
62 L A 0.0000
63 K A -2.9000
64 P A -2.3478
65 G A -1.5497
66 I A -1.6780
67 E A -2.3722
68 Y A 0.0000
69 I A -1.9379
70 V A 0.0000
71 G A -0.9655
72 I A 0.0000
73 I A -0.3684
74 G A 0.0000
75 V A -0.8840
76 K A -1.4986
77 G A -1.1377
78 G A -0.7454
79 L A 0.2260
80 R A -1.2330
81 S A 0.0000
82 N A -1.5873
83 P A -1.4752
84 L A -1.3886
85 R A -2.2575
86 A A -1.3709
87 D A -2.4320
88 F A 0.0000
89 T A -1.5192
90 T A -1.7441
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018