Project name: 194a98036b3b017

Status: done

Started: 2026-06-22 16:04:26
Settings
Chain sequence(s) B: MKRLMDMKKEFKEKKSELEKLDPVEQMKELTKLAKKIKEEVEKIKKELEA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:52)
Show buried residues

Minimal score value
-4.5412
Maximal score value
0.5137
Average score
-2.4523
Total score value
-122.6174

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.2751
2 K B -1.4986
3 R B -1.3485
4 L B -0.5433
5 M B -0.7216
6 D B -2.2956
7 M B 0.0000
8 K B -2.5115
9 K B -3.6272
10 E B -3.1993
11 F B -2.4009
12 K B -4.0642
13 E B -4.2188
14 K B -3.6052
15 K B -3.5784
16 S B -3.3977
17 E B -3.9730
18 L B 0.0000
19 E B -3.8335
20 K B -3.5464
21 L B -2.1788
22 D B -2.0754
23 P B -1.0425
24 V B 0.5137
25 E B -1.5463
26 Q B -1.9369
27 M B -0.2479
28 K B -2.1139
29 E B -2.3177
30 L B -1.2165
31 T B -1.9943
32 K B -3.1941
33 L B 0.0000
34 A B -2.4353
35 K B -3.8549
36 K B -3.5935
37 I B -2.8285
38 K B -4.1653
39 E B -4.5412
40 E B -3.5201
41 V B -3.2211
42 E B -4.3717
43 K B -4.1186
44 I B -2.7836
45 K B -3.8444
46 K B -3.9358
47 E B -2.7592
48 L B -1.2726
49 E B -2.5367
50 A B -1.3957
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018