Project name: obj1 [mutate: DY108C, WS110C, QW112C, LM115C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LM115C,DY108C,QW112C,WS110C
Energy difference between WT (input) and mutated protein (by FoldX)	5.01929 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:48)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:13)

• Minimal score value: -3.0216
• Maximal score value: 1.5454
• Average score: -0.6108
• Total score value: -73.2914

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-1.8341
2	V	C	-0.8308
3	Q	C	-1.2098
4	L	C	0.0000
5	V	C	0.7349
6	E	C	0.0000
7	S	C	-0.2946
8	G	C	-0.9306
9	G	C	-0.3002
10	G	C	0.5823
11	L	C	1.2619
12	V	C	-0.0678
13	Q	C	-1.3436
14	P	C	-1.4911
15	G	C	-1.4164
16	G	C	-0.9841
17	S	C	-1.2348
18	L	C	-0.9729
19	R	C	-2.1462
20	L	C	0.0000
21	S	C	-0.5579
22	C	C	0.0000
23	A	C	-0.3099
24	A	C	0.0000
25	S	C	-0.2629
26	D	C	0.0000
27	F	C	1.5454
28	T	C	0.2596
29	F	C	0.0000
30	R	C	-2.0221
31	S	C	-0.8694
32	Y	C	-1.1805
33	E	C	-1.0683
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.4276
40	A	C	-1.1092
41	P	C	-1.3203
42	G	C	-1.4259
43	K	C	-2.1116
44	G	C	-0.9991
45	L	C	0.5161
46	E	C	-0.3293
47	W	C	0.3724
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5759
53	G	C	-1.2326
54	S	C	-1.2239
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6487
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4731
88	A	C	-1.8890
89	E	C	-2.3435
90	D	C	0.0000
91	T	C	-0.6326
92	A	C	0.0000
93	I	C	0.8260
94	Y	C	0.0000
95	Y	C	0.8887
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-2.4215
101	D	C	-3.0216
102	G	C	-2.0175
103	F	C	-1.1618
104	N	C	-2.3590
105	K	C	-2.8707
106	G	C	-1.2791
107	F	C	0.2209
108	Y	C	0.7062	mutated: DY108C
109	Y	C	0.3124
110	S	C	0.6444	mutated: WS110C
111	G	C	0.0000
112	W	C	1.2717	mutated: QW112C
113	G	C	0.0000
114	T	C	0.0000
115	M	C	0.7254	mutated: LM115C
116	V	C	0.0000
117	T	C	0.0564
118	V	C	0.0000
119	S	C	-0.7676
120	S	C	-1.0566