Project name: 1acd44d381fa236

Status: done

Started: 2026-05-29 18:29:01
Settings
Chain sequence(s) A: LKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEMQPATFRCVLSRMSVQLGNFGM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)
Show buried residues

Minimal score value
-2.4568
Maximal score value
2.4377
Average score
-0.2719
Total score value
-19.0332

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.1404
2 K A -0.1893
3 Y A 1.0172
4 L A 1.4006
5 Q A 0.7647
6 I A 2.1623
7 I A 1.9702
8 F A 2.4377
9 L A 0.8716
10 H A -0.5717
11 S A -1.0372
12 N A -1.5603
13 S A -1.1839
14 I A -1.0390
15 A A -1.3235
16 R A -2.3636
17 V A 0.0000
18 G A -1.6403
19 V A -1.1109
20 N A -2.0018
21 D A -2.4568
22 F A -1.0711
23 C A 0.0000
24 P A -1.1143
25 T A -0.8584
26 V A -0.4240
27 P A -0.7212
28 K A -1.7119
29 M A -0.8772
30 K A -2.4124
31 K A -2.2948
32 S A -1.1826
33 L A 0.6517
34 Y A 1.0879
35 S A 0.0000
36 A A 0.9915
37 I A 0.0000
38 S A 0.0000
39 L A 0.0000
40 F A 0.6773
41 N A -0.6655
42 N A 0.0000
43 P A -0.8979
44 V A 0.0000
45 K A -0.7268
46 Y A 0.2631
47 W A 0.4267
48 E A -1.7742
49 M A -1.1089
50 Q A -1.1273
51 P A -1.1292
52 A A -1.1038
53 T A 0.0000
54 F A 0.0000
55 R A -1.4893
56 C A -0.5538
57 V A 0.0000
58 L A 1.0164
59 S A -0.1208
60 R A -1.4230
61 M A 0.1327
62 S A 0.0445
63 V A 0.1888
64 Q A -0.2949
65 L A 0.3931
66 G A 0.0000
67 N A 0.7314
68 F A 1.9015
69 G A 0.9264
70 M A 1.3307
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018