Project name: 1b378fed9bd9b09

Chain sequence(s)	A: KTQTSCPDGYTYDCGAAQQTCCSQYDFCGYSLYARADFDFYCTANYINTYE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:33)

• Minimal score value: -2.4203
• Maximal score value: 1.137
• Average score: -0.5725
• Total score value: -29.1999

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-2.4203
2	T	A	-1.6903
3	Q	A	-1.7841
4	T	A	-0.4834
5	S	A	-0.7574
6	C	A	-0.7265
7	P	A	-0.9617
8	D	A	-1.7257
9	G	A	-1.1944
10	Y	A	-0.5838
11	T	A	-0.5820
12	Y	A	-0.3855
13	D	A	-1.6754
14	C	A	-1.1955
15	G	A	-1.0986
16	A	A	-0.8284
17	A	A	-0.5588
18	Q	A	-1.1619
19	Q	A	-1.7641
20	T	A	0.0000
21	C	A	0.0000
22	C	A	0.0000
23	S	A	-0.4195
24	Q	A	-0.9416
25	Y	A	-0.1625
26	D	A	-1.3993
27	F	A	0.0000
28	C	A	0.0000
29	G	A	-0.4290
30	Y	A	0.1911
31	S	A	0.2774
32	L	A	0.6327
33	Y	A	1.1370
34	A	A	0.3150
35	R	A	-0.3336
36	A	A	-0.3966
37	D	A	-0.5602
38	F	A	0.0000
39	D	A	-0.6259
40	F	A	1.0678
41	Y	A	0.2984
42	C	A	0.0000
43	T	A	0.0000
44	A	A	-0.8258
45	N	A	-0.9255
46	Y	A	-0.2943
47	I	A	0.2882
48	N	A	-1.0245
49	T	A	-0.7666
50	Y	A	-0.5436
51	E	A	-2.1812