Project name: I94D

Status: done

Started: 2026-07-09 20:02:19
Settings
Chain sequence(s) A: TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLDHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:26)
Show buried residues

Minimal score value
-4.1362
Maximal score value
0.6768
Average score
-1.1608
Total score value
-163.6764

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A -0.9416
2 A A -1.6717
3 E A -2.2434
4 V A 0.0000
5 M A 0.0000
6 S A 0.0000
7 H A -0.7839
8 V A 0.0000
9 T A 0.0000
10 A A 0.0000
11 H A -0.4985
12 F A -0.6213
13 G A -1.2378
14 K A -2.4107
15 T A 0.0000
16 L A 0.0000
17 E A -3.6873
18 E A -3.7262
19 C A 0.0000
20 R A 0.0000
21 E A -3.5657
22 E A -3.3631
23 S A 0.0000
24 G A -1.8358
25 L A 0.0000
26 S A -0.5367
27 V A -0.1742
28 D A -1.3131
29 I A -0.5986
30 L A 0.0000
31 D A -2.1427
32 E A -2.1794
33 F A 0.0000
34 K A -1.2802
35 H A -1.8054
36 F A 0.0000
37 W A 0.0000
38 S A -2.1204
39 D A -3.5388
40 D A -3.0404
41 F A -1.8221
42 D A -1.9417
43 V A 0.0000
44 V A 0.4892
45 H A -0.7720
46 R A -1.8263
47 E A -1.5102
48 L A 0.0000
49 G A 0.0000
50 C A -0.8611
51 A A 0.0000
52 I A -0.1606
53 I A -0.2249
54 C A -0.9526
55 M A 0.0000
56 S A 0.0000
57 N A -1.8103
58 K A -1.9853
59 F A -0.8228
60 S A -0.9439
61 L A 0.0000
62 M A -1.6078
63 D A -2.3538
64 D A -2.9925
65 D A -2.9351
66 V A -1.7294
67 R A -1.8522
68 M A 0.0000
69 H A -0.8994
70 H A -0.7011
71 V A 0.6768
72 N A -0.5675
73 M A -0.7994
74 D A -1.8141
75 E A -2.2533
76 Y A -1.1038
77 I A 0.0000
78 K A -2.7695
79 S A -1.6418
80 F A -1.2514
81 P A -1.3535
82 N A -1.8878
83 G A 0.0000
84 Q A -2.1033
85 V A -0.1748
86 L A 0.0000
87 A A 0.0000
88 E A -2.7806
89 K A -2.2999
90 M A 0.0000
91 V A 0.0000
92 K A -2.9017
93 L A 0.0000
94 D A -1.7100
95 H A -2.4138
96 N A -2.6845
97 C A 0.0000
98 E A 0.0000
99 K A -3.2230
100 Q A -2.7335
101 F A -1.9078
102 D A -2.5603
103 T A -1.3949
104 E A -1.3680
105 T A -1.0118
106 D A -1.4269
107 D A -1.6331
108 C A -1.1130
109 T A -1.0861
110 R A 0.0000
111 V A 0.0000
112 V A 0.0000
113 K A -0.8543
114 V A 0.0000
115 A A 0.0000
116 A A -0.6879
117 C A -1.1306
118 F A 0.0000
119 K A 0.0000
120 E A -3.3619
121 D A -3.0694
122 S A 0.0000
123 R A -4.1362
124 K A -3.9192
125 E A -3.2714
126 G A -2.2796
127 I A 0.0000
128 A A -2.2587
129 P A 0.0000
130 E A -2.2741
131 V A -1.1529
132 A A -0.6049
133 M A -0.8421
134 V A 0.0000
135 E A -1.4832
136 A A -0.8926
137 V A 0.0000
138 I A -0.8460
139 E A -2.0967
140 K A -1.8148
141 Y A 0.1252
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018