Project name: GapC132_tagged_rank1_A3D_static_d10

Chain sequence(s)	A: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGQFVKVSAEREPANIDWATDGVLEHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -3.2579
• Maximal score value: 2.0487
• Average score: -0.8542
• Total score value: -112.7553

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.7674
2	G	A	-0.0866
3	S	A	-0.5522
4	S	A	-1.1439
5	H	A	-1.8621
6	H	A	-2.2633
7	H	A	-2.4075
8	H	A	-2.4402
9	H	A	-2.2639
10	H	A	-1.9144
11	S	A	-1.1119
12	S	A	-0.5510
13	G	A	0.3924
14	L	A	2.0487
15	V	A	1.7754
16	P	A	-0.0446
17	R	A	-1.7948
18	G	A	-1.4495
19	S	A	-1.2052
20	H	A	-0.6575
21	M	A	0.5523
22	A	A	0.5472
23	S	A	0.4862
24	M	A	0.8364
25	T	A	-0.1481
26	G	A	-1.0045
27	G	A	-1.3452
28	Q	A	-1.8979
29	Q	A	-1.9402
30	M	A	-0.8354
31	G	A	-1.6403
32	R	A	-2.0581
33	G	A	-0.9247
34	S	A	-0.2792
35	M	A	1.4067
36	V	A	1.8775
37	V	A	1.9624
38	K	A	0.2944
39	V	A	0.0000
40	G	A	0.0000
41	I	A	0.0000
42	N	A	-0.5878
43	G	A	-0.8734
44	F	A	0.0000
45	G	A	-0.9284
46	R	A	-1.1826
47	I	A	0.4012
48	G	A	0.0000
49	R	A	-0.5411
50	L	A	-0.1477
51	A	A	-0.1927
52	F	A	0.0000
53	R	A	-1.4246
54	R	A	-2.1051
55	I	A	0.0000
56	Q	A	-2.1208
57	N	A	-2.0886
58	V	A	-1.2022
59	E	A	-1.4341
60	G	A	0.0945
61	V	A	0.4127
62	E	A	-0.4016
63	V	A	0.0000
64	T	A	-0.4447
65	R	A	-0.4697
66	I	A	0.0000
67	N	A	0.0000
68	D	A	-0.3531
69	L	A	0.4609
70	T	A	-0.2224
71	D	A	-1.5552
72	P	A	-1.7388
73	N	A	-1.7764
74	M	A	-0.5678
75	L	A	0.0000
76	A	A	0.0000
77	H	A	-0.8087
78	L	A	-0.2618
79	L	A	0.0000
80	K	A	-1.2728
81	Y	A	-0.1619
82	D	A	-0.9392
83	T	A	-0.5427
84	T	A	-1.0344
85	Q	A	-1.5476
86	G	A	-1.7524
87	R	A	-2.5235
88	F	A	0.0000
89	D	A	-2.7191
90	G	A	-2.0760
91	T	A	-1.7264
92	V	A	0.0000
93	E	A	-2.2097
94	V	A	-1.4273
95	K	A	-2.5295
96	E	A	-2.6955
97	G	A	-1.8335
98	G	A	0.0000
99	F	A	0.0000
100	E	A	-1.7157
101	V	A	0.0000
102	N	A	-2.1897
103	G	A	-1.6486
104	Q	A	-1.5600
105	F	A	-0.3038
106	V	A	0.0000
107	K	A	-1.3875
108	V	A	-0.9179
109	S	A	-0.6757
110	A	A	-0.6529
111	E	A	-1.9527
112	R	A	-2.9012
113	E	A	-3.2579
114	P	A	-2.4477
115	A	A	-1.7414
116	N	A	-2.5257
117	I	A	-1.9364
118	D	A	-1.9352
119	W	A	-0.6942
120	A	A	-0.3812
121	T	A	-0.5005
122	D	A	0.0000
123	G	A	0.8678
124	V	A	1.5123
125	L	A	0.8656
126	E	A	-1.5128
127	H	A	-1.5412
128	H	A	-2.5711
129	H	A	-2.5336
130	H	A	-2.4404
131	H	A	-2.3171
132	H	A	-1.8322