Project name: 1bdd2def1eccc23

Status: done

Started: 2026-06-27 15:13:55
Settings
Chain sequence(s) A: MSHHHHHHSGSEYAERLTGDREKGEELLREMREEIAKILKENGIEIEPDSPEMLEFMRRVLEAALEEELELPELRIEKYYYDDYHLRYLGKELARDNEKVVKVVRDFVVKKAKEQGIPEEKGEEVAEEVLEVVGYYLAKMLYAGLLSKRNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:47)
Show buried residues

Minimal score value
-5.0037
Maximal score value
0.5387
Average score
-1.7838
Total score value
-269.357

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5387
2 S A -0.6284
3 H A -1.7449
4 H A -2.3466
5 H A -2.6787
6 H A -2.5964
7 H A -2.3900
8 H A -1.8498
9 S A -1.3347
10 G A -1.4324
11 S A -2.4486
12 E A -2.4399
13 Y A -2.0382
14 A A 0.0000
15 E A -3.7437
16 R A -2.8774
17 L A 0.0000
18 T A 0.0000
19 G A -2.7562
20 D A -3.9882
21 R A -5.0037
22 E A -4.6660
23 K A -4.2937
24 G A 0.0000
25 E A -4.8573
26 E A -4.6523
27 L A 0.0000
28 L A 0.0000
29 R A -4.3461
30 E A -3.7282
31 M A 0.0000
32 R A -2.7458
33 E A -3.5029
34 E A -2.4431
35 I A 0.0000
36 A A 0.0000
37 K A -3.6941
38 I A -2.5976
39 L A 0.0000
40 K A -4.1775
41 E A -3.5169
42 N A -2.6211
43 G A -2.4558
44 I A 0.0000
45 E A -3.4285
46 I A -2.6922
47 E A -3.4911
48 P A -3.2868
49 D A -2.9703
50 S A 0.0000
51 P A -1.5200
52 E A -2.0067
53 M A 0.0000
54 L A -1.2871
55 E A -1.2071
56 F A 0.0000
57 M A 0.0000
58 R A -1.5530
59 R A -1.7146
60 V A 0.0000
61 L A 0.0000
62 E A -1.9947
63 A A 0.0000
64 A A 0.0000
65 L A -2.3276
66 E A -2.9540
67 E A -3.2039
68 E A -3.1219
69 L A -2.3104
70 E A -2.5125
71 L A 0.0000
72 P A -1.9604
73 E A -2.9786
74 L A -1.9704
75 R A -2.7181
76 I A -1.6161
77 E A -2.4479
78 K A -2.1448
79 Y A -0.5854
80 Y A 0.3892
81 Y A 0.0000
82 D A -2.0247
83 D A -2.2422
84 Y A -0.3038
85 H A -0.5477
86 L A 0.0000
87 R A -1.4624
88 Y A -0.3255
89 L A 0.0000
90 G A 0.0000
91 K A -2.6480
92 E A -2.7685
93 L A 0.0000
94 A A 0.0000
95 R A -4.2073
96 D A -3.6292
97 N A 0.0000
98 E A -3.5216
99 K A -3.3039
100 V A 0.0000
101 V A -2.8411
102 K A -3.1158
103 V A -1.9262
104 V A 0.0000
105 R A -2.9615
106 D A -2.9347
107 F A -1.8008
108 V A 0.0000
109 V A -3.2947
110 K A -3.6322
111 K A -3.0928
112 A A 0.0000
113 K A -3.8296
114 E A -3.4809
115 Q A -2.8140
116 G A -2.0590
117 I A -2.2174
118 P A -2.4619
119 E A -3.7600
120 E A -3.6348
121 K A -3.2128
122 G A 0.0000
123 E A -4.0795
124 E A -4.0221
125 V A 0.0000
126 A A 0.0000
127 E A -3.5596
128 E A -2.8164
129 V A 0.0000
130 L A 0.0000
131 E A -2.4679
132 V A 0.0000
133 V A 0.0000
134 G A 0.0000
135 Y A 0.0000
136 Y A 0.0000
137 L A 0.0000
138 A A 0.0000
139 K A -0.9071
140 M A 0.0000
141 L A -0.4215
142 Y A -0.2458
143 A A -0.5957
144 G A 0.0000
145 L A -1.1515
146 L A -0.8925
147 S A -1.9438
148 K A -2.9220
149 R A -3.0542
150 N A -2.6542
151 S A -1.8958
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018