Project name: Nb_I [mutate: VQ5A, EV6A] [mutate: QE5A] [mutate: EV5A, VE6A]

Chain sequence(s)	A: QVQLEVSGGGLAQAGGSLRLSCVVSGRTFSPYTIGWFSQRPGKEREWVATIIGSDRSTDLDGDTYYADSVRGRFTISRNDAKNTVSLQMNSLKPEDSAVYYCALTAKGYVFTDNEYDYWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	EV5A,VE6A
Energy difference between WT (input) and mutated protein (by FoldX)	-2.89896 kcal/mol

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:34)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:48)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)

• Minimal score value: -3.9313
• Maximal score value: 1.8068
• Average score: -0.8543
• Total score value: -110.2006

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.7910
2	V	A	0.0000
3	Q	A	-1.2594
4	L	A	0.0000
5	V	A	1.3672	mutated: EV5A
6	E	A	0.0000	mutated: VE6A
7	S	A	-0.3660
8	G	A	-1.1707
9	G	A	-0.8831
10	G	A	-0.1724
11	L	A	0.8824
12	A	A	-0.1819
13	Q	A	-1.3154
14	A	A	-1.4071
15	G	A	-1.3066
16	G	A	-0.9246
17	S	A	-1.1089
18	L	A	-1.1084
19	R	A	-2.2555
20	L	A	0.0000
21	S	A	-0.2551
22	C	A	0.0000
23	V	A	0.7470
24	V	A	0.0000
25	S	A	-1.0822
26	G	A	-1.6378
27	R	A	-1.5151
28	T	A	-0.7362
29	F	A	0.0000
30	S	A	-1.2009
31	P	A	-0.9639
32	Y	A	-0.2733
33	T	A	0.0000
34	I	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	S	A	-1.6613
39	Q	A	-2.7172
40	R	A	-3.2719
41	P	A	-1.9964
42	G	A	-2.2603
43	K	A	-3.8706
44	E	A	-3.9313
45	R	A	-3.2300
46	E	A	-3.1932
47	W	A	-1.3533
48	V	A	0.0000
49	A	A	0.0000
50	T	A	0.0000
51	I	A	0.0000
52	I	A	0.0000
53	G	A	0.0000
54	S	A	-1.8072
55	D	A	-2.2528
56	R	A	-1.6386
57	S	A	-1.2412
58	T	A	-1.4902
59	D	A	-2.0762
60	L	A	-1.1912
61	D	A	-2.0990
62	G	A	-1.4232
63	D	A	-1.0976
64	T	A	-0.1553
65	Y	A	0.1197
66	Y	A	-0.5608
67	A	A	-1.4039
68	D	A	-2.4922
69	S	A	-1.7771
70	V	A	0.0000
71	R	A	-2.7210
72	G	A	-1.8376
73	R	A	-1.6872
74	F	A	0.0000
75	T	A	-0.8324
76	I	A	0.0000
77	S	A	-0.6038
78	R	A	-1.2126
79	N	A	-1.7068
80	D	A	-1.8740
81	A	A	-1.5092
82	K	A	-2.2679
83	N	A	-1.7605
84	T	A	-0.7824
85	V	A	0.0000
86	S	A	0.0000
87	L	A	0.0000
88	Q	A	-1.3765
89	M	A	0.0000
90	N	A	-1.3777
91	S	A	-1.1377
92	L	A	0.0000
93	K	A	-2.0230
94	P	A	-1.5946
95	E	A	-2.0310
96	D	A	0.0000
97	S	A	-1.0886
98	A	A	0.0000
99	V	A	-0.7690
100	Y	A	0.0000
101	Y	A	-0.1789
102	C	A	0.0000
103	A	A	0.0000
104	L	A	0.0000
105	T	A	0.0000
106	A	A	-1.1143
107	K	A	-1.4749
108	G	A	0.0000
109	Y	A	1.3596
110	V	A	0.9952
111	F	A	1.8068
112	T	A	-0.1186
113	D	A	-2.2998
114	N	A	-2.0962
115	E	A	0.0000
116	Y	A	0.0000
117	D	A	-2.1815
118	Y	A	-0.7545
119	W	A	-0.1081
120	G	A	0.0335
121	Q	A	-0.8108
122	G	A	0.0000
123	T	A	0.0000
124	Q	A	-1.1408
125	V	A	0.0000
126	T	A	-0.3096
127	V	A	0.0000
128	S	A	-0.7729
129	S	A	-0.8501