Project name: Nb_C

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASGELDAPFSKYSLGWFRQAPGQGLEAVAAIDAETGKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAANPSSAYDPLSPSQYDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)

• Minimal score value: -2.862
• Maximal score value: 1.7632
• Average score: -0.7724
• Total score value: -98.8613

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-2.2987
2	V	A	0.0000
3	Q	A	-1.2301
4	L	A	0.0000
5	V	A	0.5057
6	E	A	0.0000
7	S	A	-0.2593
8	G	A	-0.6470
9	G	A	0.1143
10	G	A	0.6210
11	L	A	1.3014
12	V	A	0.0000
13	Q	A	-1.4270
14	P	A	-1.6541
15	G	A	-1.4003
16	G	A	-0.9629
17	S	A	-1.3279
18	L	A	-1.1056
19	R	A	-2.2743
20	L	A	0.0000
21	S	A	-0.6052
22	C	A	0.0000
23	A	A	-0.3899
24	A	A	0.0000
25	S	A	-1.2815
26	G	A	-2.0989
27	E	A	-2.8620
28	L	A	-1.9622
29	D	A	-2.5468
30	A	A	-1.5759
31	P	A	-1.4765
32	F	A	0.0000
33	S	A	-1.7861
34	K	A	-2.5896
35	Y	A	0.0000
36	S	A	0.0000
37	L	A	0.0000
38	G	A	0.0000
39	W	A	0.0000
40	F	A	0.0000
41	R	A	0.0000
42	Q	A	-0.7667
43	A	A	-1.0303
44	P	A	-0.9718
45	G	A	-1.2820
46	Q	A	-1.8703
47	G	A	-1.2773
48	L	A	-0.5137
49	E	A	-1.0911
50	A	A	-0.4049
51	V	A	0.0000
52	A	A	0.0000
53	A	A	0.0000
54	I	A	0.0000
55	D	A	0.0000
56	A	A	-1.9936
57	E	A	-2.6395
58	T	A	-1.8381
59	G	A	-1.8031
60	K	A	-2.0239
61	T	A	-0.6585
62	Y	A	-0.3037
63	Y	A	-0.5620
64	A	A	-1.2555
65	D	A	-2.4312
66	S	A	-1.7562
67	V	A	0.0000
68	K	A	-2.5420
69	G	A	-1.7288
70	R	A	-1.5228
71	F	A	0.0000
72	T	A	-0.8924
73	I	A	0.0000
74	S	A	-0.6241
75	R	A	-1.3304
76	D	A	-1.8771
77	N	A	-2.5245
78	S	A	-1.9192
79	K	A	-2.6192
80	N	A	-2.0534
81	T	A	-1.2891
82	L	A	0.0000
83	Y	A	-0.7171
84	L	A	0.0000
85	Q	A	-1.6054
86	M	A	0.0000
87	N	A	-1.4088
88	S	A	-1.1690
89	L	A	0.0000
90	R	A	-2.3592
91	A	A	-1.7730
92	E	A	-2.2698
93	D	A	0.0000
94	T	A	-0.4194
95	A	A	0.0000
96	V	A	0.9073
97	Y	A	0.0000
98	Y	A	0.4026
99	C	A	0.0000
100	A	A	0.0000
101	A	A	0.0000
102	N	A	-1.2485
103	P	A	-1.3610
104	S	A	-1.2719
105	S	A	-0.9375
106	A	A	0.0000
107	Y	A	0.5896
108	D	A	-0.6736
109	P	A	0.0000
110	L	A	0.0755
111	S	A	-0.3475
112	P	A	-0.6057
113	S	A	-0.8125
114	Q	A	-0.8322
115	Y	A	0.0000
116	D	A	-1.7698
117	Y	A	-0.7892
118	W	A	-0.1408
119	G	A	-0.1742
120	Q	A	-0.8851
121	G	A	0.0000
122	T	A	0.6128
123	L	A	1.7632
124	V	A	0.0000
125	T	A	0.3234
126	V	A	0.0000
127	S	A	-0.8127
128	S	A	-0.5360