Project name: obj1 [mutate: EH6C, GF9C, LY45C, YL95C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LY45C,GF9C,EH6C,YL95C
Energy difference between WT (input) and mutated protein (by FoldX)	33.3667 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)

• Minimal score value: -3.3569
• Maximal score value: 1.8567
• Average score: -0.6289
• Total score value: -75.4684

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0239
2	V	C	-0.9691
3	Q	C	-1.1509
4	L	C	0.0000
5	V	C	1.1760
6	H	C	0.0000	mutated: EH6C
7	S	C	0.1159
8	G	C	-0.1395
9	F	C	1.2473	mutated: GF9C
10	G	C	1.4914
11	L	C	1.6687
12	V	C	0.1459
13	Q	C	-1.3374
14	P	C	-1.4889
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.6651
19	R	C	-1.8845
20	L	C	0.0000
21	S	C	-0.2102
22	C	C	0.0000
23	A	C	0.0473
24	A	C	0.0000
25	S	C	-0.1283
26	D	C	0.0000
27	F	C	1.5423
28	T	C	0.2494
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1610
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.4246
40	A	C	-1.0395
41	P	C	-1.2956
42	G	C	-1.4490
43	K	C	-2.1617
44	G	C	-1.1091
45	Y	C	0.2667	mutated: LY45C
46	E	C	-0.4626
47	W	C	0.2390
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3651
61	A	C	-1.1509
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6729
70	I	C	0.0000
71	S	C	-0.5637
72	R	C	-1.3636
73	D	C	-1.9811
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3157
77	N	C	-1.6466
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6447
81	L	C	0.0000
82	Q	C	-1.2345
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4724
88	A	C	-1.8898
89	E	C	-2.3446
90	D	C	0.0000
91	T	C	-0.4712
92	A	C	0.0000
93	I	C	1.0861
94	Y	C	0.0000
95	L	C	0.0000	mutated: YL95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.2433
101	D	C	-3.3569
102	G	C	-2.1033
103	F	C	-1.2490
104	N	C	-2.4466
105	K	C	-3.2163
106	G	C	-1.9781
107	F	C	-1.1555
108	D	C	-1.2058
109	Y	C	-0.3220
110	W	C	0.4498
111	G	C	0.0371
112	Q	C	-0.7545
113	G	C	0.2481
114	T	C	0.0000
115	L	C	1.8567
116	V	C	0.0000
117	T	C	0.4819
118	V	C	0.0000
119	S	C	-0.7754
120	S	C	-1.0605