Project name: query_structure

Status: done

Started: 2026-03-17 00:08:45
Settings
Chain sequence(s) A: MGSSHHHHHHYYLEVDNKFNKEFSMAMKEILALPNLNQYQKEAFKTSLKDDPSQSANLLAEAKKLNDAQAPKVD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:47)
Show buried residues

Minimal score value
-3.2193
Maximal score value
2.0576
Average score
-1.2845
Total score value
-95.0565

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7466
2 G A -0.0820
3 S A -0.5306
4 S A -1.1312
5 H A -2.0237
6 H A -2.4400
7 H A -2.6501
8 H A -2.4959
9 H A -1.8223
10 H A -0.5743
11 Y A 1.2354
12 Y A 2.0576
13 L A 1.6004
14 E A -0.4738
15 V A -0.1183
16 D A -2.5949
17 N A -3.2193
18 K A -3.1545
19 F A -2.2518
20 N A -3.1449
21 K A -3.2188
22 E A -2.2436
23 F A -1.8681
24 S A -1.5100
25 M A -0.7964
26 A A 0.0000
27 M A 0.0000
28 K A -1.4493
29 E A -1.0744
30 I A 0.0000
31 L A -0.4027
32 A A -0.2349
33 L A -0.5329
34 P A -0.4650
35 N A -1.0448
36 L A 0.0000
37 N A -1.0643
38 Q A -1.3278
39 Y A -0.3138
40 Q A -0.7411
41 K A -1.2521
42 E A -2.0421
43 A A -1.2409
44 F A -1.1478
45 K A -1.9064
46 T A -2.1005
47 S A -2.0147
48 L A 0.0000
49 K A -3.0940
50 D A -3.1909
51 D A -2.2995
52 P A -2.1756
53 S A -1.3710
54 Q A -1.8295
55 S A 0.0000
56 A A -0.8202
57 N A -1.4995
58 L A -1.3214
59 L A -1.0403
60 A A -1.5054
61 E A -2.2762
62 A A 0.0000
63 K A -2.4670
64 K A -2.9181
65 L A -1.6085
66 N A 0.0000
67 D A -3.0109
68 A A -1.7839
69 Q A -1.8171
70 A A -1.4348
71 P A -1.2448
72 K A -1.7823
73 V A 0.0006
74 D A -1.5062
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018