Project name: 1cf3aa96beb848

Status: done

Started: 2026-06-26 08:56:20
Settings
Chain sequence(s) A: MSHHHHHHSGMKTPYEKLKEVLEKNPELQEKFYEILMMDIDSRLEDWKEMYPNGDEKQKEQLKKLEEAKKLFPEIWEKVGHDAVKFLELLLKVIENNGKAPEGLSPEEQEIADKIAEFLKNMFPEPFFWTVEEFKLVWSNWLEFHLEEDFGIDFSKYNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:58)
Show buried residues

Minimal score value
-5.0544
Maximal score value
1.5125
Average score
-1.5911
Total score value
-252.9868

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5443
2 S A -0.6371
3 H A -1.7523
4 H A -2.3575
5 H A -2.7772
6 H A -2.7661
7 H A -2.5458
8 H A -2.0678
9 S A -1.1556
10 G A -0.7765
11 M A -0.2506
12 K A -0.9826
13 T A -0.8408
14 P A -0.6887
15 Y A 0.0000
16 E A -1.6985
17 K A 0.0000
18 L A 0.0000
19 K A -2.0018
20 E A -2.0721
21 V A 0.0000
22 L A 0.0000
23 E A -3.3370
24 K A -3.1184
25 N A -2.2948
26 P A -2.5758
27 E A -2.8824
28 L A 0.0000
29 Q A -2.4302
30 E A -2.6846
31 K A -2.1786
32 F A 0.0000
33 Y A -1.1707
34 E A -1.6131
35 I A 0.0000
36 L A 0.0000
37 M A -0.9247
38 M A -0.6387
39 D A -1.5825
40 I A 0.0000
41 D A -2.1467
42 S A -2.4976
43 R A -3.3842
44 L A 0.0000
45 E A -4.0525
46 D A -3.8354
47 W A -2.7750
48 K A -3.5195
49 E A -3.3526
50 M A -1.3523
51 Y A -1.7025
52 P A -2.0363
53 N A -2.4495
54 G A -3.1115
55 D A -3.9862
56 E A -4.6892
57 K A -4.5626
58 Q A -4.0242
59 K A -5.0544
60 E A -4.8553
61 Q A -3.3828
62 L A -3.4633
63 K A -3.9206
64 K A -3.3618
65 L A 0.0000
66 E A -3.3203
67 E A -3.4543
68 A A 0.0000
69 K A -2.7017
70 K A -3.0651
71 L A -2.2717
72 F A 0.0000
73 P A -2.1079
74 E A -3.1848
75 I A 0.0000
76 W A 0.0000
77 E A -3.5256
78 K A -3.6369
79 V A 0.0000
80 G A -2.2446
81 H A -2.4659
82 D A -2.3771
83 A A 0.0000
84 V A -1.3063
85 K A -1.7105
86 F A 0.0000
87 L A 0.0000
88 E A -1.5026
89 L A 0.0000
90 L A 0.0000
91 L A 0.0000
92 K A -2.5127
93 V A 0.0000
94 I A 0.0000
95 E A -3.2207
96 N A -3.1017
97 N A -2.4399
98 G A -2.7099
99 K A -3.6767
100 A A -3.1360
101 P A 0.0000
102 E A -2.4128
103 G A -1.3825
104 L A -1.4102
105 S A -1.4256
106 P A -1.7557
107 E A -2.8692
108 E A -2.4726
109 Q A -2.7190
110 E A -3.1821
111 I A 0.0000
112 A A 0.0000
113 D A -3.2812
114 K A -2.8276
115 I A 0.0000
116 A A 0.0000
117 E A -2.9257
118 F A 0.0000
119 L A 0.0000
120 K A -2.4307
121 N A 0.0000
122 M A -1.2244
123 F A -0.4443
124 P A -1.1414
125 E A -1.9089
126 P A -1.0583
127 F A -0.2411
128 F A 1.5125
129 W A 0.3946
130 T A -0.7414
131 V A -1.5159
132 E A -2.1674
133 E A -1.1125
134 F A 0.0000
135 K A -0.9302
136 L A -0.0876
137 V A 0.5368
138 W A 0.2762
139 S A 0.0000
140 N A -0.0177
141 W A 0.4346
142 L A 0.0000
143 E A -0.6663
144 F A 0.0399
145 H A -1.1184
146 L A 0.0000
147 E A -2.0369
148 E A -2.8338
149 D A -2.6667
150 F A -1.3667
151 G A -1.5520
152 I A -1.2453
153 D A -1.7764
154 F A 0.0000
155 S A -1.6123
156 K A -2.2119
157 Y A -1.6027
158 N A -1.4138
159 S A -0.9451
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018