Project name: query_structure

Status: done

Started: 2026-03-16 22:51:00
Settings
Chain sequence(s) A: YHPIETLVDIFQEYPDEIEYIFKPSAVPLMRGGANDEGLEVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKRPK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)
Show buried residues

Minimal score value
-3.4898
Maximal score value
1.2246
Average score
-1.0808
Total score value
-82.1385

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 0.6345
2 H A -0.5297
3 P A -0.6974
4 I A 0.0970
5 E A -1.1863
6 T A -0.2015
7 L A 0.8321
8 V A -0.0010
9 D A -0.4395
10 I A 0.0000
11 F A 0.3861
12 Q A -1.1054
13 E A -1.0856
14 Y A -0.4205
15 P A -0.8331
16 D A -1.5623
17 E A -0.3345
18 I A 1.0697
19 E A -0.4694
20 Y A 0.1685
21 I A 1.2246
22 F A 0.0000
23 K A -1.4525
24 P A -1.3552
25 S A -0.4126
26 A A -0.2276
27 V A 0.0000
28 P A 0.0175
29 L A 0.0000
30 M A -0.9709
31 R A -1.6033
32 G A -1.5820
33 G A -1.2035
34 A A -1.6295
35 N A -2.4069
36 D A -3.1258
37 E A -3.1731
38 G A -1.9915
39 L A -1.2048
40 E A -1.8250
41 V A -1.3891
42 P A -1.8735
43 T A -2.6704
44 E A -3.4898
45 E A -3.3970
46 S A -1.8428
47 N A -1.4761
48 I A -0.3766
49 T A -0.7586
50 M A -1.0730
51 Q A -1.6951
52 I A 0.0000
53 M A -0.4701
54 R A -0.5958
55 I A -0.4480
56 K A -1.1462
57 P A -1.3060
58 H A -1.9341
59 Q A -2.2217
60 G A -1.9530
61 Q A -1.4629
62 H A -0.5441
63 I A 0.4466
64 G A -0.7407
65 E A -1.9483
66 M A 0.0000
67 S A -0.8171
68 F A 0.0000
69 L A -0.8090
70 Q A -1.5131
71 H A -2.6825
72 N A -2.5238
73 K A -2.8579
74 R A -3.4656
75 P A -2.0908
76 K A -2.4120
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018