Project name: 1db4672522e85dd

Chain sequence(s)	A: MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:11)

• Minimal score value: -4.1871
• Maximal score value: 4.1094
• Average score: -0.117
• Total score value: -14.3954

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.4329
2	A	A	-0.2915
3	R	A	-1.1608
4	G	A	0.1376
5	S	A	0.7420
6	A	A	1.3140
7	L	A	2.5595
8	L	A	3.4059
9	L	A	3.8553
10	A	A	3.1438
11	S	A	3.0805
12	L	A	4.1094
13	L	A	4.0432
14	L	A	3.5968
15	A	A	2.4610
16	A	A	1.8893
17	A	A	1.8670
18	L	A	2.2401
19	S	A	1.2016
20	A	A	1.0037
21	S	A	0.9591
22	A	A	1.0009
23	G	A	0.8125
24	L	A	1.7537
25	W	A	1.5847
26	S	A	0.2841
27	P	A	-0.5966
28	A	A	-1.5952
29	K	A	-3.4691
30	E	A	-4.1871
31	K	A	-3.8911
32	R	A	-3.4933
33	G	A	-1.3106
34	W	A	0.3514
35	T	A	0.3934
36	L	A	1.7515
37	N	A	0.1543
38	S	A	0.6000
39	A	A	1.1146
40	G	A	1.8697
41	Y	A	2.5425
42	L	A	2.7214
43	L	A	2.6819
44	G	A	1.6879
45	P	A	0.6901
46	H	A	-0.2946
47	A	A	0.6070
48	V	A	0.6617
49	G	A	-1.0850
50	N	A	-1.9528
51	H	A	-2.1489
52	R	A	-2.0810
53	S	A	-0.9630
54	F	A	0.3783
55	S	A	-1.1484
56	D	A	-2.6323
57	K	A	-3.1198
58	N	A	-2.4286
59	G	A	-1.1152
60	L	A	0.9470
61	T	A	0.0567
62	S	A	-1.3813
63	K	A	-3.0440
64	R	A	-3.4977
65	E	A	-2.8673
66	L	A	-1.0684
67	R	A	-2.1798
68	P	A	-2.1958
69	E	A	-3.4496
70	D	A	-3.3426
71	D	A	-2.9388
72	M	A	-1.1439
73	K	A	-1.8328
74	P	A	-0.8655
75	G	A	-0.7911
76	S	A	-0.2185
77	F	A	0.2458
78	D	A	-1.6516
79	R	A	-1.7369
80	S	A	-1.0754
81	I	A	0.2431
82	P	A	-0.5204
83	E	A	-1.2581
84	N	A	-1.5587
85	N	A	-1.0559
86	I	A	1.1113
87	M	A	0.9295
88	R	A	-0.5153
89	T	A	0.9290
90	I	A	3.1711
91	I	A	3.0400
92	E	A	1.3854
93	F	A	3.4463
94	L	A	2.9377
95	S	A	1.7265
96	F	A	2.3884
97	L	A	1.2628
98	H	A	-0.3720
99	L	A	0.2285
100	K	A	-1.7671
101	E	A	-2.3653
102	A	A	-1.1938
103	G	A	-1.7890
104	A	A	-1.0982
105	L	A	-0.6199
106	D	A	-2.1597
107	R	A	-1.5140
108	L	A	0.7653
109	L	A	1.0662
110	D	A	-0.3423
111	L	A	0.8724
112	P	A	0.3130
113	A	A	-0.0595
114	A	A	0.1753
115	A	A	-0.2886
116	S	A	-1.0445
117	S	A	-1.3030
118	E	A	-2.6102
119	D	A	-2.5537
120	I	A	-0.7238
121	E	A	-2.5196
122	R	A	-2.5964
123	S	A	-1.2461