Project name: obj1 [mutate: VL5C, EW6C, LT11C, TM114C, TI117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	TI117C,LT11C,TM114C,EW6C,VL5C
Energy difference between WT (input) and mutated protein (by FoldX)	26.4191 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:49)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)

• Minimal score value: -3.3333
• Maximal score value: 1.5458
• Average score: -0.6771
• Total score value: -81.2547

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9165
3	Q	C	-1.2862
4	L	C	0.0000
5	L	C	0.5583	mutated: VL5C
6	W	C	0.0000	mutated: EW6C
7	S	C	-0.2679
8	G	C	-0.7219
9	G	C	-0.1561
10	G	C	0.2978
11	T	C	0.0261	mutated: LT11C
12	V	C	-0.6452
13	Q	C	-1.5870
14	P	C	-1.5815
15	G	C	-1.4165
16	G	C	-1.1562
17	S	C	-1.2367
18	L	C	-1.1519
19	R	C	-2.1387
20	L	C	0.0000
21	S	C	-0.4544
22	C	C	0.0000
23	A	C	-0.2292
24	A	C	0.0000
25	S	C	-0.2279
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0336
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1467
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3311
40	A	C	-0.9453
41	P	C	-1.2896
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3979
46	E	C	-0.3909
47	W	C	0.3410
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5864
53	G	C	-1.2475
54	S	C	-1.2332
55	G	C	-1.0911
56	G	C	-0.7390
57	S	C	-0.3052
58	T	C	0.1979
59	Y	C	0.6094
60	Y	C	-0.3527
61	A	C	-1.1371
62	D	C	-2.3436
63	S	C	-1.7145
64	V	C	0.0000
65	K	C	-2.3837
66	G	C	-1.6171
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6717
70	I	C	0.0000
71	S	C	-0.5648
72	R	C	-1.3652
73	D	C	-1.9819
74	N	C	-2.1913
75	S	C	-1.7905
76	K	C	-2.3184
77	N	C	-1.6525
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6469
81	L	C	0.0000
82	Q	C	-1.2342
83	M	C	0.0000
84	N	C	-1.3338
85	S	C	-1.2329
86	L	C	0.0000
87	R	C	-2.3883
88	A	C	-1.7507
89	E	C	-2.2508
90	D	C	0.0000
91	T	C	-0.3908
92	A	C	0.0000
93	I	C	1.1968
94	Y	C	0.0000
95	Y	C	0.7567
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.0994
109	Y	C	-0.2104
110	W	C	0.5660
111	G	C	0.0107
112	Q	C	-0.7390
113	G	C	0.0000
114	M	C	0.9156	mutated: TM114C
115	L	C	1.5438
116	V	C	0.0000
117	I	C	0.3773	mutated: TI117C
118	V	C	0.0000
119	S	C	-0.9023
120	S	C	-0.9843