Project name: 1dd2eada45842a

Chain sequence(s)	T: IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQENMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLR
Selected Chain(s)	T
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with T chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:55)

• Minimal score value: -3.4215
• Maximal score value: 1.906
• Average score: -1.046
• Total score value: -145.4

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
122	I	T	0.0925
123	E	T	-2.1751
124	E	T	-3.1257
125	Q	T	-2.1700
126	A	T	-1.9611
127	K	T	-3.3094
128	T	T	-2.6550
129	F	T	-1.8195
130	L	T	-2.0781
131	D	T	-3.3668
132	K	T	-3.3597
133	F	T	-2.1407
134	N	T	-2.2127
135	H	T	-3.2012
136	E	T	-3.3167
137	A	T	0.0000
138	E	T	-2.0471
139	D	T	-2.3554
140	L	T	-1.3777
141	F	T	-0.8073
142	Y	T	-1.1297
143	Q	T	-1.1880
144	S	T	-1.2874
145	S	T	-0.4149
146	L	T	-0.2400
147	A	T	-0.9982
148	S	T	-0.6490
149	W	T	0.0000
150	N	T	-1.1336
151	Y	T	-1.1207
152	N	T	-0.3203
153	T	T	-0.8705
154	N	T	-1.3927
155	I	T	-1.0765
156	T	T	-2.0610
157	E	T	-2.9524
158	E	T	-3.1915
159	N	T	-2.5864
160	V	T	-2.2422
161	Q	T	-3.3146
162	N	T	-3.2396
163	M	T	-2.7490
164	N	T	-3.2239
165	N	T	-3.4215
166	A	T	-2.5689
167	G	T	-2.6202
168	D	T	-3.2529
169	K	T	-2.8752
170	W	T	-1.3779
171	S	T	-1.6356
172	A	T	-1.8727
173	F	T	0.0000
174	L	T	-1.3914
175	K	T	-2.4002
176	E	T	-2.5484
177	Q	T	-1.3967
178	S	T	-1.2967
179	T	T	-0.9952
180	L	T	-0.1069
181	A	T	-0.0776
182	Q	T	-0.2371
183	M	T	0.9498
184	Y	T	0.7367
185	P	T	0.4132
186	L	T	0.6711
187	Q	T	-0.4502
188	E	T	-1.1599
189	N	T	-1.5203
190	M	T	-0.8179
191	T	T	-0.8488
192	Q	T	-1.6123
193	G	T	-1.3877
194	F	T	0.0000
195	W	T	-0.2827
196	E	T	-1.9685
197	N	T	-1.7533
198	S	T	-0.4993
199	M	T	-0.1993
200	L	T	0.2341
201	T	T	-0.6662
202	D	T	-1.7932
203	P	T	-1.3848
204	G	T	-1.1485
205	N	T	-1.2656
206	V	T	0.1765
207	Q	T	-1.0877
208	K	T	-1.5545
209	A	T	-0.6753
210	V	T	0.3822
211	C	T	0.1367
212	H	T	-0.4079
213	P	T	-0.3564
214	T	T	-0.4365
215	A	T	-0.8833
216	W	T	-0.9504
217	D	T	-2.2794
218	L	T	0.0000
219	G	T	-1.8897
220	K	T	-2.5332
221	G	T	-1.8523
222	D	T	-1.6830
223	F	T	0.0000
224	R	T	0.0000
225	I	T	0.0000
226	L	T	0.0000
227	M	T	0.0000
228	C	T	-0.5066
229	T	T	-0.4875
230	K	T	-0.8040
231	V	T	1.1577
232	T	T	0.8308
233	M	T	1.2857
234	D	T	-0.3868
235	D	T	0.1623
236	F	T	1.9060
237	L	T	1.0833
238	T	T	-0.0374
239	A	T	0.1174
240	H	T	-0.7726
241	H	T	-1.2182
242	E	T	-1.1830
243	M	T	-0.8234
244	G	T	-1.1778
245	H	T	-1.5005
246	I	T	0.0000
247	Q	T	-0.7922
248	Y	T	0.5050
249	D	T	-0.8897
250	M	T	-0.4965
251	A	T	0.4097
252	Y	T	0.8225
253	A	T	-0.2245
254	A	T	0.0261
255	Q	T	-0.3601
256	P	T	-0.5108
257	F	T	0.2083
258	L	T	0.9467
259	L	T	0.6411
260	R	T	-0.8393