Project name: query_structure

Status: done

Started: 2026-03-16 20:39:01
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGWTQPFQISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVSLRPYWYSGTLQVEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)
Show buried residues

Minimal score value
-3.0366
Maximal score value
1.9444
Average score
-0.5984
Total score value
-61.0339

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.9065
2 Q A -0.9373
3 V A 0.0000
4 D A -1.2769
5 I A 0.0000
6 V A 1.0820
7 P A 0.1957
8 S A -0.5792
9 Q A -1.6422
10 G A 0.0000
11 E A -2.4458
12 I A 0.0000
13 S A -0.9274
14 V A -0.2765
15 G A -1.3237
16 E A -2.2861
17 S A -1.0872
18 K A -0.4779
19 F A 1.9444
20 F A 0.0000
21 L A 0.9602
22 C A 0.0000
23 Q A -1.3464
24 V A 0.0000
25 A A -0.4039
26 G A -0.1249
27 W A 0.1557
28 T A -0.3121
29 Q A -0.3296
30 P A -1.0426
31 F A -1.2098
32 Q A -1.6932
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.0894
37 S A -1.1772
38 P A -1.1177
39 N A -1.9648
40 G A -2.0665
41 E A -2.9184
42 K A -2.1721
43 L A 0.0000
44 T A -1.0689
45 P A -1.0007
46 N A -2.2174
47 Q A -2.5483
48 Q A -2.3998
49 R A -1.7937
50 I A 0.0000
51 S A -0.4397
52 V A 0.0000
53 V A 0.9082
54 W A -0.2071
55 N A -1.6910
56 D A -2.9110
57 D A -3.0366
58 S A -1.9439
59 S A -1.5359
60 S A 0.0000
61 T A 0.8205
62 L A 0.0000
63 T A 0.8520
64 I A 0.0000
65 Y A -0.7175
66 N A -2.0282
67 A A 0.0000
68 N A -1.0165
69 I A 0.0616
70 D A -1.5355
71 D A 0.0000
72 A A -0.5330
73 G A -0.1342
74 I A 0.6037
75 Y A 0.0000
76 K A -0.9563
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 S A -1.2615
81 L A 0.0000
82 R A -1.4865
83 P A 0.0000
84 Y A 1.5945
85 W A 1.8489
86 Y A 1.2489
87 S A 0.3226
88 G A -0.1436
89 T A -0.7002
90 L A -0.4411
91 Q A -1.5227
92 V A -0.9382
93 E A -1.9912
94 A A -1.2213
95 T A -0.5391
96 V A 0.0000
97 N A -0.9650
98 V A 0.0000
99 K A -1.2952
100 I A 0.0000
101 F A 0.1810
102 Q A -0.2707
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018