Project name: 1df13125a00ab03

Chain sequence(s)	H: EVLLVESGGGLVKPGGSLKLSCAASGFTFRTSAMSWVRQTPERRLEWVASISSGGSYTFYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAIYYCARDYDSYDYAMDYWGQGTSVAVSS
Selected Chain(s)	H
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)

• Minimal score value: -3.5326
• Maximal score value: 1.4992
• Average score: -0.5047
• Total score value: -60.5678

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	H	-1.6079
2	V	H	-0.1589
3	L	H	0.7330
4	L	H	0.0000
5	V	H	0.9805
6	E	H	0.0000
7	S	H	-0.5062
8	G	H	-0.9184
9	G	H	-0.3506
10	G	H	0.3002
11	L	H	1.1154
12	V	H	-0.2835
13	K	H	-1.8912
14	P	H	-1.9079
15	G	H	-1.5282
16	G	H	-0.9966
17	S	H	-1.0954
18	L	H	-0.7335
19	K	H	-1.8641
20	L	H	0.0000
21	S	H	-0.2991
22	C	H	0.0000
23	A	H	0.0685
24	A	H	0.0000
25	S	H	-0.3446
26	G	H	-0.7273
27	F	H	-0.4205
28	T	H	-0.7106
29	F	H	0.0000
30	R	H	-2.5054
31	T	H	-1.2987
32	S	H	0.0000
33	A	H	-0.6735
34	M	H	0.0000
35	S	H	0.2840
36	W	H	0.0000
37	V	H	0.0000
38	R	H	0.0000
39	Q	H	-1.2871
40	T	H	0.0000
41	P	H	-2.1731
42	E	H	-3.3350
43	R	H	-3.5326
44	R	H	-2.9589
45	L	H	-0.6062
46	E	H	-0.2466
47	W	H	0.5869
48	V	H	0.0000
49	A	H	0.0000
50	S	H	0.4879
51	I	H	0.0000
52	S	H	-0.1071
53	S	H	-0.9807
54	G	H	-1.0136
55	G	H	-0.5641
56	S	H	0.1516
57	Y	H	1.2607
58	T	H	1.0311
59	F	H	1.0034
60	Y	H	-0.3672
61	P	H	-1.1115
62	D	H	-2.4411
63	S	H	-1.7811
64	V	H	0.0000
65	K	H	-2.4851
66	G	H	-1.7145
67	R	H	-1.4712
68	F	H	0.0000
69	T	H	-0.6182
70	I	H	0.0000
71	S	H	-0.2617
72	R	H	-1.1483
73	D	H	-1.7104
74	N	H	-2.1799
75	A	H	-1.6001
76	K	H	-2.4237
77	N	H	-2.0030
78	T	H	-1.1132
79	L	H	0.0000
80	Y	H	-0.2803
81	L	H	0.0000
82	Q	H	-1.0431
83	M	H	0.0000
84	S	H	-0.9857
85	S	H	-1.1342
86	L	H	0.0000
87	R	H	-2.7194
88	S	H	-2.1992
89	E	H	-2.4941
90	D	H	0.0000
91	T	H	-0.7487
92	A	H	0.0000
93	I	H	0.2012
94	Y	H	0.0000
95	Y	H	0.2715
96	C	H	0.0000
97	A	H	0.0000
98	R	H	-0.2450
99	D	H	-0.3129
100	Y	H	0.5688
101	D	H	-0.9641
102	S	H	0.2067
103	Y	H	1.3217
104	D	H	0.8245
105	Y	H	1.4992
106	A	H	1.0741
107	M	H	0.8851
108	D	H	0.4252
109	Y	H	1.1822
110	W	H	0.9673
111	G	H	0.4071
112	Q	H	-0.6396
113	G	H	-0.2533
114	T	H	-0.2158
115	S	H	-0.0118
116	V	H	0.0000
117	A	H	-0.1467
118	V	H	0.0000
119	S	H	-1.0309
120	S	H	-0.9235