Project name: query_structure

Status: done

Started: 2026-03-16 22:48:00
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVVFYDITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAKYLWYSGYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:23)
Show buried residues

Minimal score value
-2.688
Maximal score value
2.6026
Average score
-0.2979
Total score value
-27.4083

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7824
2 S A 0.7694
3 S A 0.6671
4 V A 0.4654
5 P A 0.0000
6 T A -1.6714
7 K A -2.6880
8 L A 0.0000
9 E A -1.9190
10 V A 0.1202
11 V A 1.5497
12 A A 0.9070
13 A A 0.3139
14 T A -0.3321
15 P A -1.1235
16 T A -1.0024
17 S A -0.5211
18 L A 0.0000
19 L A 0.7695
20 I A 0.0000
21 S A -0.9706
22 W A 0.0000
23 D A -2.6490
24 A A -1.2569
25 P A 0.0053
26 A A 0.4488
27 V A 0.9577
28 T A 0.7614
29 V A 0.8870
30 V A 1.4057
31 F A 0.6749
32 Y A 0.0000
33 D A -0.1598
34 I A 0.0000
35 T A -0.4326
36 Y A -0.3072
37 G A 0.0000
38 E A -1.8271
39 T A -1.4247
40 G A -1.3846
41 G A -1.3654
42 N A -1.6811
43 S A -0.8581
44 P A -0.2702
45 V A 0.4871
46 Q A -0.7335
47 E A -1.5336
48 F A -0.5813
49 T A -0.1831
50 V A 0.0000
51 P A -0.4503
52 G A -0.3333
53 S A -0.8691
54 K A -1.9330
55 S A -1.3621
56 T A -0.7499
57 A A 0.0000
58 T A 0.2467
59 I A 0.0000
60 S A -0.6536
61 G A -1.0268
62 L A 0.0000
63 K A -2.4256
64 P A -1.6813
65 G A -1.4951
66 V A -1.5763
67 D A -2.1974
68 Y A 0.0000
69 T A -0.8517
70 I A 0.0000
71 T A -0.1275
72 V A 0.0000
73 Y A 0.5806
74 A A 0.0000
75 K A 1.2079
76 Y A 0.0000
77 L A 2.6026
78 W A 2.4962
79 Y A 2.2815
80 S A 1.0128
81 G A 0.9551
82 Y A 1.2622
83 S A 0.0000
84 S A 0.1482
85 P A 0.2340
86 I A 0.0143
87 S A -0.5651
88 I A -0.7480
89 N A -1.7614
90 Y A -1.4957
91 R A -2.5844
92 T A -1.6590
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018