Project name: solublempnn

Status: done

Started: 2026-04-21 04:31:11
Settings
Chain sequence(s) A: SNEDKYEKQKEFIKSSKEDTAAFYREAGLFYKSWGDNDEATEYFDKALSFELDQETRDAIESLRPQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:56)
Show buried residues

Minimal score value
-4.7472
Maximal score value
0.2579
Average score
-1.9883
Total score value
-131.2291

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -2.2907
2 N A -3.6339
3 E A -4.3913
4 D A -4.6976
5 K A -4.6653
6 Y A -3.7437
7 E A -4.7472
8 K A -4.6168
9 Q A -3.0837
10 K A -3.0646
11 E A -3.3468
12 F A -1.2935
13 I A 0.0000
14 K A -2.6289
15 S A -1.8332
16 S A -2.1947
17 K A -3.1442
18 E A -3.3807
19 D A -2.9391
20 T A -1.5569
21 A A 0.0000
22 A A -0.9797
23 F A -1.3185
24 Y A 0.0000
25 R A -1.4984
26 E A -1.6544
27 A A 0.0000
28 G A 0.0000
29 L A -0.4653
30 F A -0.5121
31 Y A 0.0000
32 K A -1.5216
33 S A -0.5170
34 W A -0.5966
35 G A -1.4577
36 D A -2.1734
37 N A -3.1652
38 D A -3.4210
39 E A -2.9718
40 A A 0.0000
41 T A -3.0768
42 E A -3.4196
43 Y A -2.4371
44 F A 0.0000
45 D A -2.8885
46 K A -2.3523
47 A A 0.0000
48 L A -0.9555
49 S A -0.3810
50 F A 0.2579
51 E A -0.8366
52 L A -0.1599
53 D A -1.7770
54 Q A -3.0771
55 E A -3.5033
56 T A 0.0000
57 R A -3.5240
58 D A -3.8488
59 A A 0.0000
60 I A -2.7197
61 E A -2.7043
62 S A -1.9918
63 L A -2.0546
64 R A -2.7247
65 P A -1.7892
66 Q A -1.7597
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018