Project name: 1e2cf3e10c57ca2

Status: done

Started: 2026-06-01 14:51:32
Settings
Chain sequence(s) A: QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQHFDHLPLAFGGGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:35)
Show buried residues

Minimal score value
-2.933
Maximal score value
0.972
Average score
-0.6821
Total score value
-167.7844

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
426 Q A -1.6138
427 V A -1.2966
428 Q A -2.0558
429 L A 0.0000
430 Q A -1.8791
431 E A 0.0000
432 S A -0.7342
433 G A -0.4384
434 P A 0.0444
435 G A 0.5083
436 L A 0.9720
437 V A 0.0000
438 K A -1.9497
439 P A -1.4002
440 S A -1.2698
441 E A -1.6686
442 T A -1.2337
443 L A 0.0000
444 S A -0.7818
445 L A 0.0000
446 T A -0.6120
447 C A 0.0000
448 T A -1.1763
449 V A 0.0000
450 S A -1.4619
451 G A -1.2684
452 G A -0.9657
453 S A -0.6332
454 V A 0.0000
455 S A -0.2953
456 S A -0.6239
457 G A -0.8083
458 D A -1.5806
459 Y A -0.3598
460 Y A 0.1160
461 W A 0.0000
462 T A 0.0000
463 W A 0.0000
464 I A 0.0000
465 R A 0.0000
466 Q A -0.6460
467 S A -0.8197
468 P A -0.8938
469 G A -1.4622
470 K A -2.2789
471 G A -1.4452
472 L A 0.0000
473 E A -0.9285
474 W A 0.0000
475 I A 0.0000
476 G A 0.0000
477 H A 0.0000
478 I A 0.0000
479 Y A -0.0163
480 Y A 0.1713
481 S A -0.2986
482 G A -0.6836
483 N A -1.3296
484 T A -0.8068
485 N A -0.9231
486 Y A -0.6666
487 N A -0.6969
488 P A -1.0973
489 S A -0.8834
490 L A 0.0000
491 K A -2.0739
492 S A -1.3021
493 R A -1.3220
494 L A 0.0000
495 T A -0.9124
496 I A 0.0000
497 S A -0.4438
498 I A -0.4197
499 D A -1.1025
500 T A -0.9372
501 S A -1.2845
502 K A -2.0915
503 T A -1.3548
504 Q A -1.2274
505 F A 0.0000
506 S A -0.4826
507 L A 0.0000
508 K A -1.1912
509 L A 0.0000
510 S A -0.9663
511 S A -1.0211
512 V A 0.0000
513 T A -0.6213
514 A A -0.2858
515 A A 0.0328
516 D A 0.0000
517 T A 0.3019
518 A A 0.0000
519 I A 0.5841
520 Y A 0.0000
521 Y A 0.0000
522 C A 0.0000
523 V A 0.0000
524 R A -0.3997
525 D A 0.0000
526 R A -0.5852
527 V A 0.3169
528 T A -0.0034
529 G A 0.0000
530 A A 0.0000
531 F A 0.0000
532 D A -0.6496
533 I A 0.0000
534 W A -1.0610
535 G A 0.0000
536 Q A -1.8982
537 G A -0.8792
538 T A -0.1854
539 M A 0.7112
540 V A 0.0000
541 T A 0.3565
542 V A 0.0000
543 S A -0.6429
544 S A -1.1275
545 G A -1.4002
546 G A -1.1357
547 G A -1.2365
548 G A -1.1775
549 S A -1.0328
550 G A -1.2143
551 G A -1.2134
552 G A -1.2078
553 G A -1.2357
554 S A -1.0736
555 G A -1.2209
556 G A -1.2332
557 G A -1.2145
558 G A -1.2322
559 S A -1.0827
560 G A -1.2873
561 G A -1.3139
562 G A -1.3631
563 G A -1.2761
564 S A -1.5781
565 D A -1.9088
566 I A 0.0000
567 Q A -1.9794
568 M A 0.0000
569 T A -1.1586
570 Q A -0.7384
571 S A -0.6723
572 P A -0.5216
573 S A -0.6698
574 S A -0.8126
575 L A -0.6975
576 S A -1.1497
577 A A 0.0000
578 S A -0.7575
579 V A -0.0075
580 G A -0.8083
581 D A -1.6573
582 R A -2.2949
583 V A 0.0000
584 T A -0.6300
585 I A 0.0000
586 T A -0.8072
587 C A 0.0000
588 Q A -2.3610
589 A A 0.0000
590 S A -2.1097
591 Q A -2.9107
592 D A -2.9330
593 I A 0.0000
594 S A -1.4285
595 N A -1.3689
596 Y A -0.3592
597 L A 0.0000
598 N A 0.0000
599 W A 0.0000
600 Y A 0.0000
601 Q A 0.0000
602 Q A -1.2675
603 K A -1.7341
604 P A -1.1438
605 G A -1.6442
606 K A -2.4765
607 A A -1.6170
608 P A 0.0000
609 K A -1.6470
610 L A 0.0000
611 L A 0.0000
612 I A 0.0000
613 Y A -0.5898
614 D A -1.3021
615 A A 0.0000
616 S A -1.1064
617 N A -1.2774
618 L A -0.3694
619 E A -0.5284
620 T A -0.4326
621 G A -0.5297
622 V A 0.0000
623 P A -0.4491
624 S A -0.4528
625 R A -0.7371
626 F A 0.0000
627 S A -0.4566
628 G A 0.0000
629 S A -1.1087
630 G A -1.4226
631 S A -1.6004
632 G A -1.9136
633 T A -2.4087
634 D A -2.7320
635 F A 0.0000
636 T A -0.7926
637 F A 0.0000
638 T A -0.5798
639 I A 0.0000
640 S A -1.3008
641 S A -1.1546
642 L A 0.0000
643 Q A -0.8092
644 P A -0.9079
645 E A -1.7150
646 D A 0.0000
647 I A -0.6578
648 A A 0.0000
649 T A -0.6853
650 Y A 0.0000
651 F A 0.0000
652 C A 0.0000
653 Q A 0.0000
654 H A 0.0000
655 F A -0.0107
656 D A -0.9664
657 H A -0.5205
658 L A 0.0981
659 P A -0.1899
660 L A 0.0000
661 A A -0.5982
662 F A 0.0000
663 G A 0.0000
664 G A -1.2246
665 G A 0.0000
666 T A 0.0000
667 K A -1.1103
668 V A 0.0000
669 E A -1.3418
670 I A -0.9458
671 K A -1.6115
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018