Project name: query_structure

Status: done

Started: 2026-03-16 22:49:52
Settings
Chain sequence(s) A: VYPKKTHWTAEITPNLHGTEVVVAGWVWELRDIGRVKFVVVRDREGGAPVQVTLKAGKTPDHLFKVFAELSREDVVVIKGIVEASKIAKSGVEIFPSEIWILNKAKPLPID
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:31)
Show buried residues

Minimal score value
-3.1155
Maximal score value
2.1569
Average score
-0.8448
Total score value
-93.7687

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 2.1569
2 Y A 1.5960
3 P A -0.1830
4 K A -1.6001
5 K A -1.2886
6 T A -1.2144
7 H A -0.7272
8 W A -1.1110
9 T A 0.0000
10 A A -1.1436
11 E A -1.3758
12 I A 0.0000
13 T A -1.0761
14 P A -1.5210
15 N A -1.8095
16 L A -1.4492
17 H A -1.7761
18 G A -1.3326
19 T A -1.3171
20 E A -1.8672
21 V A 0.0000
22 V A 0.0000
23 V A 0.0000
24 A A -0.5490
25 G A 0.0000
26 W A -1.2719
27 V A 0.0000
28 W A -1.0305
29 E A -1.2983
30 L A -1.1101
31 R A -1.4794
32 D A -1.6734
33 I A 0.2032
34 G A -1.1066
35 R A -1.9810
36 V A -1.2462
37 K A -0.9804
38 F A -0.4511
39 V A 0.0000
40 V A 0.0000
41 V A 0.0000
42 R A -1.8174
43 D A -1.9596
44 R A -3.0867
45 E A -3.0942
46 G A -2.1542
47 G A -1.5780
48 A A -0.9280
49 P A 0.0000
50 V A 0.0000
51 Q A 0.0000
52 V A 0.0000
53 T A 0.0000
54 L A 0.0000
55 K A -1.8747
56 A A -1.9012
57 G A -1.8387
58 K A -2.0906
59 T A 0.0000
60 P A -1.9543
61 D A -2.7761
62 H A -2.1791
63 L A 0.0000
64 F A -1.6748
65 K A -2.2859
66 V A -1.2078
67 F A 0.0000
68 A A -1.2016
69 E A -1.7256
70 L A 0.0000
71 S A -2.0556
72 R A -2.5937
73 E A -2.9130
74 D A 0.0000
75 V A -0.7703
76 V A 0.0000
77 V A 0.0000
78 I A 0.0000
79 K A -1.2767
80 G A 0.0000
81 I A -0.3596
82 V A 0.0000
83 E A -1.1345
84 A A -0.9060
85 S A -0.7098
86 K A -1.0955
87 I A 0.7114
88 A A 0.0000
89 K A -1.5469
90 S A -0.8908
91 G A -0.8626
92 V A 0.0000
93 E A 0.0000
94 I A 0.0000
95 F A 0.0000
96 P A 0.0000
97 S A -1.2066
98 E A -0.8329
99 I A 0.0000
100 W A 0.8335
101 I A 0.3179
102 L A 0.2129
103 N A -1.8646
104 K A -3.1155
105 A A -2.4933
106 K A -2.4314
107 P A -0.7458
108 L A 0.7432
109 P A 0.7443
110 I A 1.4598
111 D A -0.6438
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018